.
The Open Protein Structure Annotation Network
PDB Keyword
.

417913

    This page can't be edited.
    Table of contents
    to the older version or return to version archive.

    Combined revision comparison

    Comparing version 17:42, 8 Nov 2012 by haxelrod with version 21:35, 9 Nov 2012 by adam.
    {{ template.Protein{ leadContact:"", title:"",site:'JCSG', status:'Diffraction-quality Crystals', date:"2012-10-11", targetid:"417913", pdbid:"", source:"Bacteroides uniformis atcc 8492", relatedPDBs:[], refids:"ZP_02071597.1, 323185", molwt:"16193.57", residues:"141", isopoint:"4.90", sequence:"qesaefrpaelagiwqlchyvseipdvpgilkpsntfkvlsddgrivnftmipgkdaiitgygtyqqlt dnsykesieknihlpmldhkdnilefeigddgvmylkyfiakdlngnelntwfhetwkrvgmpakfped lvr", method:"", numchains:"", resolution:"", rfree:"", mattcoeff:"", rfactor:"", waters:"", solcontent:"", ligands:"", metals:"", model:"False", uniprot:"", pubmed:"" } }}

    ...

    Target id 417913, a.k.a. BACUNI_03039 protein from Bacteroides uniformis ATCC 8492, is a member of a newly defined PF14869 (DUF4488) (still not in the official release) and is highly similar to another rencent JCSG structure 4gzv, so this is the second representative structure of this PFAM family417913 belongs to the PfamB class PB007936 with this being the first representative structure for this Pfam class. Shown below is a ribbons representation of the structure of target id 417913

    ...


    Other changes:

    1. /body/p[3]/img/@style: nothing ⇒ ""

    Version from 17:42, 8 Nov 2012

    This revision modified by haxelrod (Ban)
    {{ template.Protein{ leadContact:"", title:"",site:'JCSG', status:'Diffraction-quality Crystals', date:"2012-10-11", targetid:"417913", pdbid:"", source:"Bacteroides uniformis atcc 8492", relatedPDBs:[], refids:"ZP_02071597.1, 323185", molwt:"16193.57", residues:"141", isopoint:"4.90", sequence:"qesaefrpaelagiwqlchyvseipdvpgilkpsntfkvlsddgrivnftmipgkdaiitgygtyqqlt dnsykesieknihlpmldhkdnilefeigddgvmylkyfiakdlngnelntwfhetwkrvgmpakfped lvr", method:"", numchains:"", resolution:"", rfree:"", mattcoeff:"", rfactor:"", waters:"", solcontent:"", ligands:"", metals:"", model:"False", uniprot:"", pubmed:"" } }}

    ...

    Target id 417913 belongs to the PfamB class PB007936 with this being the first representative structure for this Pfam class. Shown below is a ribbons representation of the structure of target id 417913

    ...


    Current version

    This revision modified by adam (Ban)
    {{ template.Protein{ leadContact:"", title:"",site:'JCSG', status:'Diffraction-quality Crystals', date:"2012-10-11", targetid:"417913", pdbid:"", source:"Bacteroides uniformis atcc 8492", relatedPDBs:[], refids:"ZP_02071597.1, 323185", molwt:"16193.57", residues:"141", isopoint:"4.90", sequence:"qesaefrpaelagiwqlchyvseipdvpgilkpsntfkvlsddgrivnftmipgkdaiitgygtyqqlt dnsykesieknihlpmldhkdnilefeigddgvmylkyfiakdlngnelntwfhetwkrvgmpakfped lvr", method:"", numchains:"", resolution:"", rfree:"", mattcoeff:"", rfactor:"", waters:"", solcontent:"", ligands:"", metals:"", model:"False", uniprot:"", pubmed:"" } }}

    ...

    Target id 417913, a.k.a. BACUNI_03039 protein from Bacteroides uniformis ATCC 8492, is a member of a newly defined PF14869 (DUF4488) (still not in the official release) and is highly similar to another rencent JCSG structure 4gzv, so this is the second representative structure of this PFAM family. Shown below is a ribbons representation of the structure of target id 417913

    ...


    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch