.
The Open Protein Structure Annotation Network
PDB Keyword
.

417913

    This page can't be edited.
    Table of contents
    You are currently comparing two old versions - only when you are comparing against the latest version can you revert. Return to version archive.

    Combined revision comparison

    Comparing version 16:31, 8 Nov 2012 by haxelrod with version 17:42, 8 Nov 2012 by haxelrod.
    {{ template.Protein{ leadContact:"", title:"",site:'JCSG', status:'Diffraction-quality Crystals', date:"2012-10-11", targetid:"417913", pdbid:"", source:"Bacteroides uniformis atcc 8492", relatedPDBs:[], refids:"ZP_02071597.1, 323185", molwt:"16193.57", residues:"141", isopoint:"4.90", sequence:"qesaefrpaelagiwqlchyvseipdvpgilkpsntfkvlsddgrivnftmipgkdaiitgygtyqqlt dnsykesieknihlpmldhkdnilefeigddgvmylkyfiakdlngnelntwfhetwkrvgmpakfped lvr", method:"", numchains:"", resolution:"", rfree:"", mattcoeff:"", rfactor:"", waters:"", solcontent:"", ligands:"", metals:"", model:"False", uniprot:"", pubmed:"" } }}

    ...

    Shown below is a schematic representation of the putative active site on target id 417913. Two glutamic acid sidechains (labeled in red) are positioned similar to those found on glucoside hydroylases. This suggests that target id 417913 is a hydrolase and the unknown ligand is a sugar molecule. In addition, whereas related lipocalins bind hydrophobic ligands, target id 417913 binds more polar ligands.

    ...


    Other changes:

    1. /body/p[12]/img/@style: nothing ⇒ ""

    Version from 16:31, 8 Nov 2012

    This revision modified by haxelrod (Ban)
    {{ template.Protein{ leadContact:"", title:"",site:'JCSG', status:'Diffraction-quality Crystals', date:"2012-10-11", targetid:"417913", pdbid:"", source:"Bacteroides uniformis atcc 8492", relatedPDBs:[], refids:"ZP_02071597.1, 323185", molwt:"16193.57", residues:"141", isopoint:"4.90", sequence:"qesaefrpaelagiwqlchyvseipdvpgilkpsntfkvlsddgrivnftmipgkdaiitgygtyqqlt dnsykesieknihlpmldhkdnilefeigddgvmylkyfiakdlngnelntwfhetwkrvgmpakfped lvr", method:"", numchains:"", resolution:"", rfree:"", mattcoeff:"", rfactor:"", waters:"", solcontent:"", ligands:"", metals:"", model:"False", uniprot:"", pubmed:"" } }}

    ...


    Version as of 17:42, 8 Nov 2012

    This revision modified by haxelrod (Ban)
    {{ template.Protein{ leadContact:"", title:"",site:'JCSG', status:'Diffraction-quality Crystals', date:"2012-10-11", targetid:"417913", pdbid:"", source:"Bacteroides uniformis atcc 8492", relatedPDBs:[], refids:"ZP_02071597.1, 323185", molwt:"16193.57", residues:"141", isopoint:"4.90", sequence:"qesaefrpaelagiwqlchyvseipdvpgilkpsntfkvlsddgrivnftmipgkdaiitgygtyqqlt dnsykesieknihlpmldhkdnilefeigddgvmylkyfiakdlngnelntwfhetwkrvgmpakfped lvr", method:"", numchains:"", resolution:"", rfree:"", mattcoeff:"", rfactor:"", waters:"", solcontent:"", ligands:"", metals:"", model:"False", uniprot:"", pubmed:"" } }}

    ...

    Shown below is a schematic representation of the putative active site on target id 417913. Two glutamic acid sidechains (labeled in red) are positioned similar to those found on glucoside hydroylases. This suggests that target id 417913 is a hydrolase and the unknown ligand is a sugar molecule. In addition, whereas related lipocalins bind hydrophobic ligands, target id 417913 binds more polar ligands.

    ...


    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch