.
The Open Protein Structure Annotation Network
PDB Keyword
.

417913

    This page can't be edited.
    Table of contents
    You are currently comparing two old versions - only when you are comparing against the latest version can you revert. Return to version archive.

    Combined revision comparison

    Comparing version 16:22, 8 Nov 2012 by haxelrod with version 16:31, 8 Nov 2012 by haxelrod.
    {{ template.Protein{ leadContact:"", title:"",site:'JCSG', status:'Diffraction-quality Crystals', date:"2012-10-11", targetid:"417913", pdbid:"", source:"Bacteroides uniformis atcc 8492", relatedPDBs:[], refids:"ZP_02071597.1, 323185", molwt:"16193.57", residues:"141", isopoint:"4.90", sequence:"qesaefrpaelagiwqlchyvseipdvpgilkpsntfkvlsddgrivnftmipgkdaiitgygtyqqlt dnsykesieknihlpmldhkdnilefeigddgvmylkyfiakdlngnelntwfhetwkrvgmpakfped lvr", method:"", numchains:"", resolution:"", rfree:"", mattcoeff:"", rfactor:"", waters:"", solcontent:"", ligands:"", metals:"", model:"False", uniprot:"", pubmed:"" } }}

    ...

    A DALI structural similaritry search of the PDB databases shows that target id 417913 is similar to the following related structures:

    ...

    Target id 417913 shows structural similarity to another JCSG target, PDB ID 3hty.

    The structure of target id 417913 shows an unknown ligand (UNL) bound to a putative site. Shown below is a representation of this UNL superimposed on its 2fo-fc electron density contoured at 1 sigma. A molecule similar to xylose will model into this density, suggesting that this unknown ligand is a monosaccharide.

    ...


    Version from 16:22, 8 Nov 2012

    This revision modified by haxelrod (Ban)
    {{ template.Protein{ leadContact:"", title:"",site:'JCSG', status:'Diffraction-quality Crystals', date:"2012-10-11", targetid:"417913", pdbid:"", source:"Bacteroides uniformis atcc 8492", relatedPDBs:[], refids:"ZP_02071597.1, 323185", molwt:"16193.57", residues:"141", isopoint:"4.90", sequence:"qesaefrpaelagiwqlchyvseipdvpgilkpsntfkvlsddgrivnftmipgkdaiitgygtyqqlt dnsykesieknihlpmldhkdnilefeigddgvmylkyfiakdlngnelntwfhetwkrvgmpakfped lvr", method:"", numchains:"", resolution:"", rfree:"", mattcoeff:"", rfactor:"", waters:"", solcontent:"", ligands:"", metals:"", model:"False", uniprot:"", pubmed:"" } }}

    ...


    Version as of 16:31, 8 Nov 2012

    This revision modified by haxelrod (Ban)
    {{ template.Protein{ leadContact:"", title:"",site:'JCSG', status:'Diffraction-quality Crystals', date:"2012-10-11", targetid:"417913", pdbid:"", source:"Bacteroides uniformis atcc 8492", relatedPDBs:[], refids:"ZP_02071597.1, 323185", molwt:"16193.57", residues:"141", isopoint:"4.90", sequence:"qesaefrpaelagiwqlchyvseipdvpgilkpsntfkvlsddgrivnftmipgkdaiitgygtyqqlt dnsykesieknihlpmldhkdnilefeigddgvmylkyfiakdlngnelntwfhetwkrvgmpakfped lvr", method:"", numchains:"", resolution:"", rfree:"", mattcoeff:"", rfactor:"", waters:"", solcontent:"", ligands:"", metals:"", model:"False", uniprot:"", pubmed:"" } }}

    ...

    A DALI structural similaritry search of the PDB databases shows that target id 417913 is similar to the following related structures:

    ...

    Target id 417913 shows structural similarity to another JCSG target, PDB ID 3hty.

    The structure of target id 417913 shows an unknown ligand (UNL) bound to a putative site. Shown below is a representation of this UNL superimposed on its 2fo-fc electron density contoured at 1 sigma. A molecule similar to xylose will model into this density, suggesting that this unknown ligand is a monosaccharide.

    ...


    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch