.
The Open Protein Structure Annotation Network
PDB Keyword
.

417913

    This page can't be edited.
    Table of contents
    You are currently comparing two old versions - only when you are comparing against the latest version can you revert. Return to version archive.

    Combined revision comparison

    Comparing version 16:06, 8 Nov 2012 by haxelrod with version 16:10, 8 Nov 2012 by haxelrod.
    {{ template.Protein{ leadContact:"", title:"",site:'JCSG', status:'Diffraction-quality Crystals', date:"2012-10-11", targetid:"417913", pdbid:"", source:"Bacteroides uniformis atcc 8492", relatedPDBs:[], refids:"ZP_02071597.1, 323185", molwt:"16193.57", residues:"141", isopoint:"4.90", sequence:"qesaefrpaelagiwqlchyvseipdvpgilkpsntfkvlsddgrivnftmipgkdaiitgygtyqqlt dnsykesieknihlpmldhkdnilefeigddgvmylkyfiakdlngnelntwfhetwkrvgmpakfped lvr", method:"", numchains:"", resolution:"", rfree:"", mattcoeff:"", rfactor:"", waters:"", solcontent:"", ligands:"", metals:"", model:"False", uniprot:"", pubmed:"" } }}

    ...

    PDB ID Z-score rmsd (Ang) length of alignment total residues %sequence id description Ligand
    1bbp 8.9 2.4 98 173 11 MOLECULAR STRUCTURE OF THE BILIN BINDING PROTEIN (BBP) FROM PIERIS BRASSICAE AFTER REFINEMENT AT 2.0 ANGSTROMS RESOLUTION.[Ref] BILIVERDIN IX GAMMA CHROMOPHORE
    3rby 8.4 4.5 114 245 11 Crystal structure of uncharacterized protein YLR301w from Saccharomycces cerevisiae  
    3hty 8.1 2.6 82 94 9 Crystal structure of hypothetical protein BT_0869 from Bacteroides thetaiotaomicron VPI-5482 (NP_809782.1) at 1.95 A resolution (JCSG Structure)  
     2hzr  8.0  3.1  99  161  7  Crystal structure of human apolipoprotein D (ApoD)[Ref]  
     2hzq  7.8  3.1  99  166  7  Crystal structure of human apolipoprotein D (ApoD) in complex with progesterone [Ref]  Progesterone
                   
                   
                   
                   
                   
     

    ...


    Version from 16:06, 8 Nov 2012

    This revision modified by haxelrod (Ban)
    {{ template.Protein{ leadContact:"", title:"",site:'JCSG', status:'Diffraction-quality Crystals', date:"2012-10-11", targetid:"417913", pdbid:"", source:"Bacteroides uniformis atcc 8492", relatedPDBs:[], refids:"ZP_02071597.1, 323185", molwt:"16193.57", residues:"141", isopoint:"4.90", sequence:"qesaefrpaelagiwqlchyvseipdvpgilkpsntfkvlsddgrivnftmipgkdaiitgygtyqqlt dnsykesieknihlpmldhkdnilefeigddgvmylkyfiakdlngnelntwfhetwkrvgmpakfped lvr", method:"", numchains:"", resolution:"", rfree:"", mattcoeff:"", rfactor:"", waters:"", solcontent:"", ligands:"", metals:"", model:"False", uniprot:"", pubmed:"" } }}

    ...


    Version as of 16:10, 8 Nov 2012

    This revision modified by haxelrod (Ban)
    {{ template.Protein{ leadContact:"", title:"",site:'JCSG', status:'Diffraction-quality Crystals', date:"2012-10-11", targetid:"417913", pdbid:"", source:"Bacteroides uniformis atcc 8492", relatedPDBs:[], refids:"ZP_02071597.1, 323185", molwt:"16193.57", residues:"141", isopoint:"4.90", sequence:"qesaefrpaelagiwqlchyvseipdvpgilkpsntfkvlsddgrivnftmipgkdaiitgygtyqqlt dnsykesieknihlpmldhkdnilefeigddgvmylkyfiakdlngnelntwfhetwkrvgmpakfped lvr", method:"", numchains:"", resolution:"", rfree:"", mattcoeff:"", rfactor:"", waters:"", solcontent:"", ligands:"", metals:"", model:"False", uniprot:"", pubmed:"" } }}

    ...

    PDB ID Z-score rmsd (Ang) length of alignment total residues %sequence id description Ligand
    1bbp 8.9 2.4 98 173 11 MOLECULAR STRUCTURE OF THE BILIN BINDING PROTEIN (BBP) FROM PIERIS BRASSICAE AFTER REFINEMENT AT 2.0 ANGSTROMS RESOLUTION.[Ref] BILIVERDIN IX GAMMA CHROMOPHORE
    3rby 8.4 4.5 114 245 11 Crystal structure of uncharacterized protein YLR301w from Saccharomycces cerevisiae  
    3hty 8.1 2.6 82 94 9 Crystal structure of hypothetical protein BT_0869 from Bacteroides thetaiotaomicron VPI-5482 (NP_809782.1) at 1.95 A resolution (JCSG Structure)  
    2hzr 8.0 3.1 99 161 7 Crystal structure of human apolipoprotein D (ApoD)[Ref]  
    2hzq 7.8 3.1 99 166 7 Crystal structure of human apolipoprotein D (ApoD) in complex with progesterone [Ref] Progesterone
                   
                   
                   
                   
                   

    ...


    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch