.
The Open Protein Structure Annotation Network
PDB Keyword
.

416853

    This page can't be edited.
    Table of contents
    You are currently comparing two old versions - only when you are comparing against the latest version can you revert. Return to version archive.

    Combined revision comparison

    Comparing version 00:02, 26 Oct 2012 by debanu with version 00:04, 26 Oct 2012 by debanu.
    {{ template.Protein{ leadContact:"", title:"",site:'JCSG', status:'Diffraction', date:"2012-09-25", targetid:"416853", pdbid:"", source:"Ruminococcus gnavus atcc 29149", relatedPDBs:[], refids:"ZP_02040096.1, 327498", molwt:"27544.00", residues:"251", isopoint:"4.42", sequence:"eekgssedaktikvaasatphaeileqaksilkkegyqlevtvfddyvqpnevvesgefdanyfqhvpy lesfneekgthlvdagdihyepfgiypgtkksldeisegdkiavpndttnearallllqdngiitlkdg aglnatvndieenpynveiveleaaqvarvtgetayvvlngnyaleagysvakdalayeksdseaakty vniiavkegnekeekiqalvkalksdeikeyiektydgavipfe", method:"", numchains:"", resolution:"", rfree:"", mattcoeff:"", rfactor:"", waters:"", solcontent:"", ligands:"", metals:"", model:"False", uniprot:"", pubmed:"" } }}

    ...

    JCSG has solved several similar structures with PDB ids 4ef1, 4ef2, 4got, 3up9, etc and there are several other related structures. See TOPSAN page for 4ef1.

    ...


    Version from 00:02, 26 Oct 2012

    This revision modified by debanu (Ban)
    {{ template.Protein{ leadContact:"", title:"",site:'JCSG', status:'Diffraction', date:"2012-09-25", targetid:"416853", pdbid:"", source:"Ruminococcus gnavus atcc 29149", relatedPDBs:[], refids:"ZP_02040096.1, 327498", molwt:"27544.00", residues:"251", isopoint:"4.42", sequence:"eekgssedaktikvaasatphaeileqaksilkkegyqlevtvfddyvqpnevvesgefdanyfqhvpy lesfneekgthlvdagdihyepfgiypgtkksldeisegdkiavpndttnearallllqdngiitlkdg aglnatvndieenpynveiveleaaqvarvtgetayvvlngnyaleagysvakdalayeksdseaakty vniiavkegnekeekiqalvkalksdeikeyiektydgavipfe", method:"", numchains:"", resolution:"", rfree:"", mattcoeff:"", rfactor:"", waters:"", solcontent:"", ligands:"", metals:"", model:"False", uniprot:"", pubmed:"" } }}

    ...


    Version as of 00:04, 26 Oct 2012

    This revision modified by debanu (Ban)
    {{ template.Protein{ leadContact:"", title:"",site:'JCSG', status:'Diffraction', date:"2012-09-25", targetid:"416853", pdbid:"", source:"Ruminococcus gnavus atcc 29149", relatedPDBs:[], refids:"ZP_02040096.1, 327498", molwt:"27544.00", residues:"251", isopoint:"4.42", sequence:"eekgssedaktikvaasatphaeileqaksilkkegyqlevtvfddyvqpnevvesgefdanyfqhvpy lesfneekgthlvdagdihyepfgiypgtkksldeisegdkiavpndttnearallllqdngiitlkdg aglnatvndieenpynveiveleaaqvarvtgetayvvlngnyaleagysvakdalayeksdseaakty vniiavkegnekeekiqalvkalksdeikeyiektydgavipfe", method:"", numchains:"", resolution:"", rfree:"", mattcoeff:"", rfactor:"", waters:"", solcontent:"", ligands:"", metals:"", model:"False", uniprot:"", pubmed:"" } }}

    ...

    JCSG has solved several similar structures with PDB ids 4ef1, 4ef2, 4got, 3up9, etc and there are several other related structures. See TOPSAN page for 4ef1.

    ...


    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch