.
The Open Protein Structure Annotation Network
PDB Keyword
.

416853

    This page can't be edited.
    Table of contents
    You are currently comparing two old versions - only when you are comparing against the latest version can you revert. Return to version archive.

    Combined revision comparison

    Comparing version 18:37, 18 Oct 2012 by Admin with version 23:57, 25 Oct 2012 by debanu.
    {{ template.Protein{ leadContact:"", title:"",site:'JCSG', status:'Diffraction', date:"2012-09-25", targetid:"416853", pdbid:"", source:"Ruminococcus gnavus atcc 29149", relatedPDBs:[], refids:"ZP_02040096.1, 327498", molwt:"27544.00", residues:"251", isopoint:"4.42", sequence:"eekgssedaktikvaasatphaeileqaksilkkegyqlevtvfddyvqpnevvesgefdanyfqhvpy lesfneekgthlvdagdihyepfgiypgtkksldeisegdkiavpndttnearallllqdngiitlkdg aglnatvndieenpynveiveleaaqvarvtgetayvvlngnyaleagysvakdalayeksdseaakty vniiavkegnekeekiqalvkalksdeikeyiektydgavipfe", method:"", numchains:"", resolution:"", rfree:"", mattcoeff:"", rfactor:"", waters:"", solcontent:"", ligands:"", metals:"", model:"False", uniprot:"", pubmed:"" } }}

    ...

    This target is classified in Pfam family Lipoprotein_9 (PF03180), NLPA lipoprotein.

    ...


    Other changes:

    1. /body/h4/@class: "topsan h4 topsanProtein" ⇒ nothing

    Version from 18:37, 18 Oct 2012

    This revision modified by Admin (Ban)
    {{ template.Protein{ leadContact:"", title:"",site:'JCSG', status:'Diffraction', date:"2012-09-25", targetid:"416853", pdbid:"", source:"Ruminococcus gnavus atcc 29149", relatedPDBs:[], refids:"ZP_02040096.1, 327498", molwt:"27544.00", residues:"251", isopoint:"4.42", sequence:"eekgssedaktikvaasatphaeileqaksilkkegyqlevtvfddyvqpnevvesgefdanyfqhvpy lesfneekgthlvdagdihyepfgiypgtkksldeisegdkiavpndttnearallllqdngiitlkdg aglnatvndieenpynveiveleaaqvarvtgetayvvlngnyaleagysvakdalayeksdseaakty vniiavkegnekeekiqalvkalksdeikeyiektydgavipfe", method:"", numchains:"", resolution:"", rfree:"", mattcoeff:"", rfactor:"", waters:"", solcontent:"", ligands:"", metals:"", model:"False", uniprot:"", pubmed:"" } }}

    ...


    ...


    Version as of 23:57, 25 Oct 2012

    This revision modified by debanu (Ban)
    {{ template.Protein{ leadContact:"", title:"",site:'JCSG', status:'Diffraction', date:"2012-09-25", targetid:"416853", pdbid:"", source:"Ruminococcus gnavus atcc 29149", relatedPDBs:[], refids:"ZP_02040096.1, 327498", molwt:"27544.00", residues:"251", isopoint:"4.42", sequence:"eekgssedaktikvaasatphaeileqaksilkkegyqlevtvfddyvqpnevvesgefdanyfqhvpy lesfneekgthlvdagdihyepfgiypgtkksldeisegdkiavpndttnearallllqdngiitlkdg aglnatvndieenpynveiveleaaqvarvtgetayvvlngnyaleagysvakdalayeksdseaakty vniiavkegnekeekiqalvkalksdeikeyiektydgavipfe", method:"", numchains:"", resolution:"", rfree:"", mattcoeff:"", rfactor:"", waters:"", solcontent:"", ligands:"", metals:"", model:"False", uniprot:"", pubmed:"" } }}

    ...

    This target is classified in Pfam family Lipoprotein_9 (PF03180), NLPA lipoprotein.

    ...


    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch