.
The Open Protein Structure Annotation Network
PDB Keyword
.

386390

    This page can't be edited.
    Table of contents
    You are currently comparing two old versions - only when you are comparing against the latest version can you revert. Return to version archive.

    Combined revision comparison

    Comparing version 20:49, 14 Nov 2012 by debanu with version 21:02, 14 Nov 2012 by debanu.
    {{ template.Protein{ leadContact:"", title:"",site:'JCSG', status:'Diffraction', date:"2012-10-10", targetid:"386390", pdbid:"", source:"Bacteroides thetaiotaomicron vpi-5482", relatedPDBs:[], refids:"NP_812381.1", molwt:"48408.24", residues:"430", isopoint:"8.61", sequence:"qtweplfngknlkgwkklngkaeykivdgaivgiskmgtpntflattknygdfilefdfkiddglnsgv qlrseskkdyqngrvhgyqfeidpskrawsggiydearrnwlypltlnpaaktafknnawnkarieaig nsirtwingvpcaniwddmtpsgfialqvhaignaseegktvswkdiricttdveryqtpeteeapern miantispreakegwallwdgktnngwrgaklnafpekgwkmedgilkvmksggaesanggdivttrky knfiltvdfkitegansgvkyfvnpdlnkgegsaigcefqildddkhpdaklgvkgnrklgslydlipa pekkpfnkkdfntatiivqdnhvehwlngvklieytrntdmwnalvayskyknwpnfgnsaegnillqd hgdevwfknvkikelk", method:"", numchains:"", resolution:"", rfree:"", mattcoeff:"", rfactor:"", waters:"", solcontent:"", ligands:"", metals:"", model:"False", uniprot:"", pubmed:"" } }}

    ...

    This is also a secreted protein. There are 3 other structures in the DUF1080 Pfam, all JCSG structures from gut bacteria with PDB ids 3s5q, 3nmb and 3osd.

    However, the main difference in this protein/structure is that each monomer is made up of 2 DUF1080 domains so there is a gene duplication. Out of the ~1000 sequences in the DUF1080, ~77 of them have a domain architecture of this kind where the entire protein is made up of only 2 DUF1080 domains and ~600 proteins have a only a single DUF1080 domain composition as in the other 3 structuresThis is also a secreted protein.

    ...


    Version from 20:49, 14 Nov 2012

    This revision modified by debanu (Ban)
    {{ template.Protein{ leadContact:"", title:"",site:'JCSG', status:'Diffraction', date:"2012-10-10", targetid:"386390", pdbid:"", source:"Bacteroides thetaiotaomicron vpi-5482", relatedPDBs:[], refids:"NP_812381.1", molwt:"48408.24", residues:"430", isopoint:"8.61", sequence:"qtweplfngknlkgwkklngkaeykivdgaivgiskmgtpntflattknygdfilefdfkiddglnsgv qlrseskkdyqngrvhgyqfeidpskrawsggiydearrnwlypltlnpaaktafknnawnkarieaig nsirtwingvpcaniwddmtpsgfialqvhaignaseegktvswkdiricttdveryqtpeteeapern miantispreakegwallwdgktnngwrgaklnafpekgwkmedgilkvmksggaesanggdivttrky knfiltvdfkitegansgvkyfvnpdlnkgegsaigcefqildddkhpdaklgvkgnrklgslydlipa pekkpfnkkdfntatiivqdnhvehwlngvklieytrntdmwnalvayskyknwpnfgnsaegnillqd hgdevwfknvkikelk", method:"", numchains:"", resolution:"", rfree:"", mattcoeff:"", rfactor:"", waters:"", solcontent:"", ligands:"", metals:"", model:"False", uniprot:"", pubmed:"" } }}

    ...

    There are 3 other structures in the DUF1080 Pfam, all JCSG structures from gut bacteria with PDB ids 3s5q, 3nmb and 3osd. However, the main difference in this protein/structure is that each monomer is made up of 2 DUF1080 domains so there is a gene duplication. This is also a secreted protein.

    ...


    Version as of 21:02, 14 Nov 2012

    This revision modified by debanu (Ban)
    {{ template.Protein{ leadContact:"", title:"",site:'JCSG', status:'Diffraction', date:"2012-10-10", targetid:"386390", pdbid:"", source:"Bacteroides thetaiotaomicron vpi-5482", relatedPDBs:[], refids:"NP_812381.1", molwt:"48408.24", residues:"430", isopoint:"8.61", sequence:"qtweplfngknlkgwkklngkaeykivdgaivgiskmgtpntflattknygdfilefdfkiddglnsgv qlrseskkdyqngrvhgyqfeidpskrawsggiydearrnwlypltlnpaaktafknnawnkarieaig nsirtwingvpcaniwddmtpsgfialqvhaignaseegktvswkdiricttdveryqtpeteeapern miantispreakegwallwdgktnngwrgaklnafpekgwkmedgilkvmksggaesanggdivttrky knfiltvdfkitegansgvkyfvnpdlnkgegsaigcefqildddkhpdaklgvkgnrklgslydlipa pekkpfnkkdfntatiivqdnhvehwlngvklieytrntdmwnalvayskyknwpnfgnsaegnillqd hgdevwfknvkikelk", method:"", numchains:"", resolution:"", rfree:"", mattcoeff:"", rfactor:"", waters:"", solcontent:"", ligands:"", metals:"", model:"False", uniprot:"", pubmed:"" } }}

    ...

    This is also a secreted protein. There are 3 other structures in the DUF1080 Pfam, all JCSG structures from gut bacteria with PDB ids 3s5q, 3nmb and 3osd.

    However, the main difference in this protein/structure is that each monomer is made up of 2 DUF1080 domains so there is a gene duplication. Out of the ~1000 sequences in the DUF1080, ~77 of them have a domain architecture of this kind where the entire protein is made up of only 2 DUF1080 domains and ~600 proteins have a only a single DUF1080 domain composition as in the other 3 structures.

    ...


    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch