.
The Open Protein Structure Annotation Network
PDB Keyword
.

386390

    This page can't be edited.
    Table of contents
    You are currently comparing two old versions - only when you are comparing against the latest version can you revert. Return to version archive.

    Combined revision comparison

    Comparing version 18:08, 18 Oct 2012 by Admin with version 20:45, 14 Nov 2012 by debanu.
    {{ template.Protein{ leadContact:"", title:"",site:'JCSG', status:'Diffraction', date:"2012-10-10", targetid:"386390", pdbid:"", source:"Bacteroides thetaiotaomicron vpi-5482", relatedPDBs:[], refids:"NP_812381.1", molwt:"48408.24", residues:"430", isopoint:"8.61", sequence:"qtweplfngknlkgwkklngkaeykivdgaivgiskmgtpntflattknygdfilefdfkiddglnsgv qlrseskkdyqngrvhgyqfeidpskrawsggiydearrnwlypltlnpaaktafknnawnkarieaig nsirtwingvpcaniwddmtpsgfialqvhaignaseegktvswkdiricttdveryqtpeteeapern miantispreakegwallwdgktnngwrgaklnafpekgwkmedgilkvmksggaesanggdivttrky knfiltvdfkitegansgvkyfvnpdlnkgegsaigcefqildddkhpdaklgvkgnrklgslydlipa pekkpfnkkdfntatiivqdnhvehwlngvklieytrntdmwnalvayskyknwpnfgnsaegnillqd hgdevwfknvkikelk", method:"", numchains:"", resolution:"", rfree:"", mattcoeff:"", rfactor:"", waters:"", solcontent:"", ligands:"", metals:"", model:"False", uniprot:"", pubmed:"" } }}

    ...


    This protein is classified in the Pfam family DUF1080 (PF06439) in the concanavalin clan CL0004 which are concanavalin-like lectin/glucanase proteins.

    ...


    Other changes:

    1. /body/h4/@class: "topsan h4 topsanProtein" ⇒ nothing

    Version from 18:08, 18 Oct 2012

    This revision modified by Admin (Ban)
    {{ template.Protein{ leadContact:"", title:"",site:'JCSG', status:'Diffraction', date:"2012-10-10", targetid:"386390", pdbid:"", source:"Bacteroides thetaiotaomicron vpi-5482", relatedPDBs:[], refids:"NP_812381.1", molwt:"48408.24", residues:"430", isopoint:"8.61", sequence:"qtweplfngknlkgwkklngkaeykivdgaivgiskmgtpntflattknygdfilefdfkiddglnsgv qlrseskkdyqngrvhgyqfeidpskrawsggiydearrnwlypltlnpaaktafknnawnkarieaig nsirtwingvpcaniwddmtpsgfialqvhaignaseegktvswkdiricttdveryqtpeteeapern miantispreakegwallwdgktnngwrgaklnafpekgwkmedgilkvmksggaesanggdivttrky knfiltvdfkitegansgvkyfvnpdlnkgegsaigcefqildddkhpdaklgvkgnrklgslydlipa pekkpfnkkdfntatiivqdnhvehwlngvklieytrntdmwnalvayskyknwpnfgnsaegnillqd hgdevwfknvkikelk", method:"", numchains:"", resolution:"", rfree:"", mattcoeff:"", rfactor:"", waters:"", solcontent:"", ligands:"", metals:"", model:"False", uniprot:"", pubmed:"" } }}

    ...


    ...


    Version as of 20:45, 14 Nov 2012

    This revision modified by debanu (Ban)
    {{ template.Protein{ leadContact:"", title:"",site:'JCSG', status:'Diffraction', date:"2012-10-10", targetid:"386390", pdbid:"", source:"Bacteroides thetaiotaomicron vpi-5482", relatedPDBs:[], refids:"NP_812381.1", molwt:"48408.24", residues:"430", isopoint:"8.61", sequence:"qtweplfngknlkgwkklngkaeykivdgaivgiskmgtpntflattknygdfilefdfkiddglnsgv qlrseskkdyqngrvhgyqfeidpskrawsggiydearrnwlypltlnpaaktafknnawnkarieaig nsirtwingvpcaniwddmtpsgfialqvhaignaseegktvswkdiricttdveryqtpeteeapern miantispreakegwallwdgktnngwrgaklnafpekgwkmedgilkvmksggaesanggdivttrky knfiltvdfkitegansgvkyfvnpdlnkgegsaigcefqildddkhpdaklgvkgnrklgslydlipa pekkpfnkkdfntatiivqdnhvehwlngvklieytrntdmwnalvayskyknwpnfgnsaegnillqd hgdevwfknvkikelk", method:"", numchains:"", resolution:"", rfree:"", mattcoeff:"", rfactor:"", waters:"", solcontent:"", ligands:"", metals:"", model:"False", uniprot:"", pubmed:"" } }}

    ...


    This protein is classified in the Pfam family DUF1080 (PF06439) in the concanavalin clan CL0004 which are concanavalin-like lectin/glucanase proteins.

    ...


    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch