.
The Open Protein Structure Annotation Network
PDB Keyword
.

386390

    This page can't be edited.
    Table of contents
    to the older version or return to version archive.

    Combined revision comparison

    Comparing version 21:04, 14 Nov 2012 by debanu with version 21:12, 14 Nov 2012 by debanu.
    {{ template.Protein{ leadContact:"", title:"",site:'JCSG', status:'Diffraction', date:"2012-10-10", targetid:"386390", pdbid:"", source:"Bacteroides thetaiotaomicron vpi-5482", relatedPDBs:[], refids:"NP_812381.1", molwt:"48408.24", residues:"430", isopoint:"8.61", sequence:"qtweplfngknlkgwkklngkaeykivdgaivgiskmgtpntflattknygdfilefdfkiddglnsgv qlrseskkdyqngrvhgyqfeidpskrawsggiydearrnwlypltlnpaaktafknnawnkarieaig nsirtwingvpcaniwddmtpsgfialqvhaignaseegktvswkdiricttdveryqtpeteeapern miantispreakegwallwdgktnngwrgaklnafpekgwkmedgilkvmksggaesanggdivttrky knfiltvdfkitegansgvkyfvnpdlnkgegsaigcefqildddkhpdaklgvkgnrklgslydlipa pekkpfnkkdfntatiivqdnhvehwlngvklieytrntdmwnalvayskyknwpnfgnsaegnillqd hgdevwfknvkikelk", method:"", numchains:"", resolution:"", rfree:"", mattcoeff:"", rfactor:"", waters:"", solcontent:"", ligands:"", metals:"", model:"False", uniprot:"", pubmed:"" } }}

    ...


    This protein is classified in the Pfam family DUF1080 (PF06439) in the concanavalin clan CL0004 which are concanavalin-like lectin/glucanase proteins. About 40% of the total proteins in the DUF1080 family are from bacteroidetes, and ~97% are bacterial proteins, but there are a few viral, archael and eukaryotic proteins (the 9 eukaryotic proteins are from fungi).

    ...


    Version from 21:04, 14 Nov 2012

    This revision modified by debanu (Ban)
    {{ template.Protein{ leadContact:"", title:"",site:'JCSG', status:'Diffraction', date:"2012-10-10", targetid:"386390", pdbid:"", source:"Bacteroides thetaiotaomicron vpi-5482", relatedPDBs:[], refids:"NP_812381.1", molwt:"48408.24", residues:"430", isopoint:"8.61", sequence:"qtweplfngknlkgwkklngkaeykivdgaivgiskmgtpntflattknygdfilefdfkiddglnsgv qlrseskkdyqngrvhgyqfeidpskrawsggiydearrnwlypltlnpaaktafknnawnkarieaig nsirtwingvpcaniwddmtpsgfialqvhaignaseegktvswkdiricttdveryqtpeteeapern miantispreakegwallwdgktnngwrgaklnafpekgwkmedgilkvmksggaesanggdivttrky knfiltvdfkitegansgvkyfvnpdlnkgegsaigcefqildddkhpdaklgvkgnrklgslydlipa pekkpfnkkdfntatiivqdnhvehwlngvklieytrntdmwnalvayskyknwpnfgnsaegnillqd hgdevwfknvkikelk", method:"", numchains:"", resolution:"", rfree:"", mattcoeff:"", rfactor:"", waters:"", solcontent:"", ligands:"", metals:"", model:"False", uniprot:"", pubmed:"" } }}

    ...


    Current version

    This revision modified by debanu (Ban)
    {{ template.Protein{ leadContact:"", title:"",site:'JCSG', status:'Diffraction', date:"2012-10-10", targetid:"386390", pdbid:"", source:"Bacteroides thetaiotaomicron vpi-5482", relatedPDBs:[], refids:"NP_812381.1", molwt:"48408.24", residues:"430", isopoint:"8.61", sequence:"qtweplfngknlkgwkklngkaeykivdgaivgiskmgtpntflattknygdfilefdfkiddglnsgv qlrseskkdyqngrvhgyqfeidpskrawsggiydearrnwlypltlnpaaktafknnawnkarieaig nsirtwingvpcaniwddmtpsgfialqvhaignaseegktvswkdiricttdveryqtpeteeapern miantispreakegwallwdgktnngwrgaklnafpekgwkmedgilkvmksggaesanggdivttrky knfiltvdfkitegansgvkyfvnpdlnkgegsaigcefqildddkhpdaklgvkgnrklgslydlipa pekkpfnkkdfntatiivqdnhvehwlngvklieytrntdmwnalvayskyknwpnfgnsaegnillqd hgdevwfknvkikelk", method:"", numchains:"", resolution:"", rfree:"", mattcoeff:"", rfactor:"", waters:"", solcontent:"", ligands:"", metals:"", model:"False", uniprot:"", pubmed:"" } }}

    ...


    This protein is classified in the Pfam family DUF1080 (PF06439) in the concanavalin clan CL0004 which are concanavalin-like lectin/glucanase proteins. About 40% of the total proteins in the DUF1080 family are from bacteroidetes, and ~97% are bacterial proteins, but there are a few viral, archael and eukaryotic proteins (the 9 eukaryotic proteins are from fungi).

    ...


    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch