.
The Open Protein Structure Annotation Network
PDB Keyword
.

4fbd

    This page can't be edited.
    Table of contents
    to the older version or return to version archive.

    Combined revision comparison

    Comparing version 23:16, 15 Jan 2013 by Admin with version 23:18, 15 Jan 2013 by Admin.
    {{ template.Protein{ leadContact:"", title:"2.35 AngstromThis is a dummy page. Crystal Structure of Conserved Hypothetical Protein from Toxoplasma gondii ME49. TO BE PUBLISHED",site:'CSGID', status:'In PDB', date:"2009-06-04", targetid:"IDP90278", pdbid:"4fbd", source:"Toxoplasma gondii me49", relatedPDBs:[], refids:"IDP90278, 211965291, EEB00487", molwt:"25169.36", residues:"227", isopoint:"5.36", sequence:"mtskpespqrclgrpapadlplgldpfcyrqfddpayggsrisgvtkeeflekvnelvtrdagieffqg yapfcrhlyipnfvgalpgslpitadnehllrsgyiarrpnelpvltrwfpmsyakdalmpaafldlil ysreqiaketaaesntavvidpnapawsiiavkaqnekyslpmapitmlrntlieeggsgvaldreayk asvaywkthaivmdkessle", method:"XRAY", numchains:"2", resolution:"2.35", rfree:"0.25826", mattcoeff:"2.15", rfactor:"0.20232", waters:"98", solcontent:"42.69", ligands:"", metals:"", model:"False", uniprot:"B6KHY2", pubmed:"" } }}

    Protein Summary


    Ligand Summary


    Version from 23:16, 15 Jan 2013

    This revision modified by Admin (Ban)

    This is a dummy page.


    Current version

    This revision modified by Admin (Ban)
    {{ template.Protein{ leadContact:"", title:"2.35 Angstrom Crystal Structure of Conserved Hypothetical Protein from Toxoplasma gondii ME49. TO BE PUBLISHED",site:'CSGID', status:'In PDB', date:"2009-06-04", targetid:"IDP90278", pdbid:"4fbd", source:"Toxoplasma gondii me49", relatedPDBs:[], refids:"IDP90278, 211965291, EEB00487", molwt:"25169.36", residues:"227", isopoint:"5.36", sequence:"mtskpespqrclgrpapadlplgldpfcyrqfddpayggsrisgvtkeeflekvnelvtrdagieffqg yapfcrhlyipnfvgalpgslpitadnehllrsgyiarrpnelpvltrwfpmsyakdalmpaafldlil ysreqiaketaaesntavvidpnapawsiiavkaqnekyslpmapitmlrntlieeggsgvaldreayk asvaywkthaivmdkessle", method:"XRAY", numchains:"2", resolution:"2.35", rfree:"0.25826", mattcoeff:"2.15", rfactor:"0.20232", waters:"98", solcontent:"42.69", ligands:"", metals:"", model:"False", uniprot:"B6KHY2", pubmed:"" } }}

    Protein Summary


    Ligand Summary


    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch