.
The Open Protein Structure Annotation Network
PDB Keyword
.

3uks

    This page can't be edited.
    Table of contents
    to the older version or return to version archive.

    Combined revision comparison

    Comparing version 00:54, 16 Jan 2013 by Admin with version 00:54, 16 Jan 2013 by Admin.
    {{ template.Protein{ leadContact:"", title:"1.85 Angstrom Crystal Structure of Putative Sedoheptulose-1,7 bisphosphatase from Toxoplasma gondiiThis is a dummy page. TO BE PUBLISHED",site:'CSGID', status:'In PDB', date:"2009-06-03", targetid:"IDP90286", pdbid:"3uks", source:"Toxoplasma gondii me49", relatedPDBs:[], refids:"IDP90286, 211966629, EEB01825", molwt:"35771.00", residues:"330", isopoint:"5.36", sequence:"mespsalpsldqllkeqgadqtltdlilaildrcgkiasalqgtsvdkvgsvnefgdeqltvdviaenl lrswaqssegsavravcseedihlqechkngefilcwdpldgssiidcnwavgsivsiwrighhgvqwq gadtliqktgrqqvaslivvygprttgvvavnvdaggivkegtaldlemkdngkficrgkpiikpqaki fspanlraaqdlpaykqliefwmekrytlrytgglvpdvyqifvkqqgvfcnpaskaapaklrmcfevl aialvveaaggrtsngqkslldvaiehmdhrsalccgsadeikrmeetfaalsg", method:"XRAY", numchains:"2", resolution:"1.85", rfree:"0.18467", mattcoeff:"2.34", rfactor:"0.15446", waters:"506", solcontent:"47.41", ligands:"", metals:"", model:"False", uniprot:"B9PW60", pubmed:"" } }}

    Protein Summary


    Ligand Summary


    Version from 00:54, 16 Jan 2013

    This revision modified by Admin (Ban)

    This is a dummy page.


    Current version

    This revision modified by Admin (Ban)
    {{ template.Protein{ leadContact:"", title:"1.85 Angstrom Crystal Structure of Putative Sedoheptulose-1,7 bisphosphatase from Toxoplasma gondii. TO BE PUBLISHED",site:'CSGID', status:'In PDB', date:"2009-06-03", targetid:"IDP90286", pdbid:"3uks", source:"Toxoplasma gondii me49", relatedPDBs:[], refids:"IDP90286, 211966629, EEB01825", molwt:"35771.00", residues:"330", isopoint:"5.36", sequence:"mespsalpsldqllkeqgadqtltdlilaildrcgkiasalqgtsvdkvgsvnefgdeqltvdviaenl lrswaqssegsavravcseedihlqechkngefilcwdpldgssiidcnwavgsivsiwrighhgvqwq gadtliqktgrqqvaslivvygprttgvvavnvdaggivkegtaldlemkdngkficrgkpiikpqaki fspanlraaqdlpaykqliefwmekrytlrytgglvpdvyqifvkqqgvfcnpaskaapaklrmcfevl aialvveaaggrtsngqkslldvaiehmdhrsalccgsadeikrmeetfaalsg", method:"XRAY", numchains:"2", resolution:"1.85", rfree:"0.18467", mattcoeff:"2.34", rfactor:"0.15446", waters:"506", solcontent:"47.41", ligands:"", metals:"", model:"False", uniprot:"B9PW60", pubmed:"" } }}

    Protein Summary


    Ligand Summary


    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch