.
The Open Protein Structure Annotation Network
PDB Keyword
.

3qyq

    This page can't be edited.
    Table of contents
    to the older version or return to version archive.

    Combined revision comparison

    Comparing version 00:55, 16 Jan 2013 by Admin with version 00:55, 16 Jan 2013 by Admin.
    {{ template.Protein{ leadContact:"", title:"1.8 Angstrom resolution crystal structure of a putative deoxyribose-phosphateThis is a dummy page. aldolase from Toxoplasma gondii ME49. To be Published",site:'CSGID', status:'In PDB', date:"2009-06-03", targetid:"IDP90300", pdbid:"3qyq", source:"Toxoplasma gondii me49", relatedPDBs:["4eiv"], refids:"IDP90300, 211967477, EEB02673", molwt:"30888.69", residues:"286", isopoint:"5.14", sequence:"mateqiykqftsrtllnffevaaltdgetnesvaavckiaakdpaivgvsvrpafvrfirqelvksape vagikvcaavnfpegtgtpdtvsleavgalkdgadeieclidwrrmnenvadgesrirllvsevkkvvg pktlkvvlsggelqggdiisraavaaleggadflqtssglgathatmftvhlisialreymvrenerir veginregaavrcigikievgdvhmaetadflmqmifengprsivrdkfrvgggfnllkelrdcyeswd svgvspdtsp", method:"XRAY", numchains:"4", resolution:"1.80", rfree:"0.20060", mattcoeff:"2.61", rfactor:"0.16568", waters:"958", solcontent:"52.84", ligands:"", metals:"", model:"False", uniprot:"B6KPX4", pubmed:"" } }}

    Protein Summary


    Ligand Summary


    Version from 00:55, 16 Jan 2013

    This revision modified by Admin (Ban)

    This is a dummy page.


    Current version

    This revision modified by Admin (Ban)
    {{ template.Protein{ leadContact:"", title:"1.8 Angstrom resolution crystal structure of a putative deoxyribose-phosphate aldolase from Toxoplasma gondii ME49. To be Published",site:'CSGID', status:'In PDB', date:"2009-06-03", targetid:"IDP90300", pdbid:"3qyq", source:"Toxoplasma gondii me49", relatedPDBs:["4eiv"], refids:"IDP90300, 211967477, EEB02673", molwt:"30888.69", residues:"286", isopoint:"5.14", sequence:"mateqiykqftsrtllnffevaaltdgetnesvaavckiaakdpaivgvsvrpafvrfirqelvksape vagikvcaavnfpegtgtpdtvsleavgalkdgadeieclidwrrmnenvadgesrirllvsevkkvvg pktlkvvlsggelqggdiisraavaaleggadflqtssglgathatmftvhlisialreymvrenerir veginregaavrcigikievgdvhmaetadflmqmifengprsivrdkfrvgggfnllkelrdcyeswd svgvspdtsp", method:"XRAY", numchains:"4", resolution:"1.80", rfree:"0.20060", mattcoeff:"2.61", rfactor:"0.16568", waters:"958", solcontent:"52.84", ligands:"", metals:"", model:"False", uniprot:"B6KPX4", pubmed:"" } }}

    Protein Summary


    Ligand Summary


    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch