.
The Open Protein Structure Annotation Network
PDB Keyword
.

3otr

    This page can't be edited.
    Table of contents
    to the older version or return to version archive.

    Combined revision comparison

    Comparing version 23:45, 22 Sep 2010 by Admin with version 00:54, 16 Jan 2013 by Admin.
    {{ template.Protein{ leadContact:"", title:"2.75 Angstrom Crystal Structure of Enolase 1 from Toxoplasma gondii. TO BE PUBLISHED",site:'CSGID', status:'In PDB', date:"2009-06-03", targetid:"IDP90293", pdbid:"3otr", source:"Toxoplasma gondii me49", relatedPDBs:[], refids:"IDP90293, 211963243, EEA98438508771, 211963243", molwt:"48338.75", residues:"444", isopoint:"6.01", sequence:"mvvikdivareildsrgnptievdvsteggvfraavpsgastgiyealelrdkdpkrylgkgvlnavei vrqeikpallgkdpcdqkgidmlmveqldgtknewgysksklganailgvsiaccragaaskglplyky iatlagktidkmvmpvpffnvinggehagnglalqefliapvgapnireairygsetyhhlknviknky gldatnvgdeggfapnvataeealnllveaikaagyegkikiafdaaasefykqdekkydldykcktkn askhltgeklkevyegwlkkypiisvedpfdqddfasfsaftkdvgektqvigddilvtnilriekalk dkacnclllkvnqigsvteaieacllaqksgwgvqvshrsgetedsfiadlvvglrcgqiksgspcrse rlckynqlmrieeslgadcvyagesfrhpk", method:"XRAY", numchains:"6", resolution:"2.75",:"", numchains:"", resolution:"", rfree:"0.21881", mattcoeff:"2.94", rfactor:"0.17084", waters:"578",:"", solcontent:"58.23", ligands:"", metals:"", model:"False", uniprot:"B6KCK6", pubmed:"" } }}

    ...


    ...


    Version from 23:45, 22 Sep 2010

    This revision modified by Admin (Ban)
    {{ template.Protein{ leadContact:"", title:"2.75 Angstrom Crystal Structure of Enolase 1 from Toxoplasma gondii. TO BE PUBLISHED",site:'CSGID', status:'In PDB', date:"2009-06-03", targetid:"IDP90293", pdbid:"3otr", source:"Toxoplasma gondii me49", relatedPDBs:[], refids:"508771, 211963243", molwt:"48338.75", residues:"444", isopoint:"6.01", sequence:"mvvikdivareildsrgnptievdvsteggvfraavpsgastgiyealelrdkdpkrylgkgvlnavei vrqeikpallgkdpcdqkgidmlmveqldgtknewgysksklganailgvsiaccragaaskglplyky iatlagktidkmvmpvpffnvinggehagnglalqefliapvgapnireairygsetyhhlknviknky gldatnvgdeggfapnvataeealnllveaikaagyegkikiafdaaasefykqdekkydldykcktkn askhltgeklkevyegwlkkypiisvedpfdqddfasfsaftkdvgektqvigddilvtnilriekalk dkacnclllkvnqigsvteaieacllaqksgwgvqvshrsgetedsfiadlvvglrcgqiksgspcrse rlckynqlmrieeslgadcvyagesfrhpk", method:"", numchains:"", resolution:"", rfree:"0.21881", mattcoeff:"2.94", rfactor:"0.17084", waters:"", solcontent:"58.23", ligands:"", metals:"", model:"False", uniprot:"B6KCK6", pubmed:"" } }}

    ...


    ...


    Current version

    This revision modified by Admin (Ban)
    {{ template.Protein{ leadContact:"", title:"2.75 Angstrom Crystal Structure of Enolase 1 from Toxoplasma gondii. TO BE PUBLISHED",site:'CSGID', status:'In PDB', date:"2009-06-03", targetid:"IDP90293", pdbid:"3otr", source:"Toxoplasma gondii me49", relatedPDBs:[], refids:"IDP90293, 211963243, EEA98438", molwt:"48338.75", residues:"444", isopoint:"6.01", sequence:"mvvikdivareildsrgnptievdvsteggvfraavpsgastgiyealelrdkdpkrylgkgvlnavei vrqeikpallgkdpcdqkgidmlmveqldgtknewgysksklganailgvsiaccragaaskglplyky iatlagktidkmvmpvpffnvinggehagnglalqefliapvgapnireairygsetyhhlknviknky gldatnvgdeggfapnvataeealnllveaikaagyegkikiafdaaasefykqdekkydldykcktkn askhltgeklkevyegwlkkypiisvedpfdqddfasfsaftkdvgektqvigddilvtnilriekalk dkacnclllkvnqigsvteaieacllaqksgwgvqvshrsgetedsfiadlvvglrcgqiksgspcrse rlckynqlmrieeslgadcvyagesfrhpk", method:"XRAY", numchains:"6", resolution:"2.75", rfree:"0.21881", mattcoeff:"2.94", rfactor:"0.17084", waters:"578", solcontent:"58.23", ligands:"", metals:"", model:"False", uniprot:"B6KCK6", pubmed:"" } }}

    ...


    ...


    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch