.
The Open Protein Structure Annotation Network
PDB Keyword
.

ISFI504

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Site Zygmunt Derewenda
    Status Purified
    Target Id ISFI504
    Molecular Characteristics
    Source Thermotoga maritima
    Alias Ids TPS32679, TM0107 Molecular Weight 22413.59 Da.
    Residues 190 Isoelectric Point 5.22
    Sequence mdertellkrieeleeklrqcqqreqelealieeynevmkkqfqvfddffeklgttkmidpltrvyakdh flrllsyqhqrafeentpytiffvktkvsknerekalmkigkilkecvrvpldsvgrysddtfalfvig vgketapnieeriknhiesiggieysiayksypedfmdlekaildlekava
      BLAST   FFAS

    Access denied for user 'root'@'localhost' (using password: YES) (click for details)

    Ligand Information
    Ligands
    Metals
    Modeled
    Model TM0107
    generated 12/2008
    Google Scholar output for

    Protein Summary

     

    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch