.
The Open Protein Structure Annotation Network
PDB Keyword
.

ISFI390

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Site Zygmunt Derewenda
    Status Diffraction-quality Crystals
    Target Id ISFI390
    Molecular Characteristics
    Source Thermotoga maritima
    Alias Ids TPS32362, TM0152 Molecular Weight 24471.81 Da.
    Residues 215 Isoelectric Point 8.28
    Sequence mslreelwlwkkeklaehvannlrkkkhevwiardreeilervkelipegatvsaggsltladtgviell rsgrynfldraaaktreeveeiyrksfwadyyftsvnaitedgklvfldgngnrvaavvfgpknvvvia svnkvvkdveearerlryispmnskrlnletpctktgfcadcsspqricdyflvvesgvrqpgrfkvil tledfgl
      BLAST   FFAS

    Access denied for user 'root'@'localhost' (using password: YES) (click for details)

    Ligand Information
    Ligands
    Metals
    Modeled
    Model TM0152
    generated 12/2008
    Google Scholar output for

    Protein Summary

     

    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch