The Open Protein Structure Annotation Network
PDB Keyword


    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Site XMTB
    PDB Id 2bt5 Target Id rv2140c
    Molecular Characteristics
    Source Mycobacterium tuberculosis h37rv
    Alias Ids TPS12000, Molecular Weight 18632.92 Da.
    Residues 176 Isoelectric Point 5.41
    Sequence mttspdpyaalpklpsfsltstsitdgqplatpqvsgimgaggadaspqlrwsgfpsetrsfavtvydp daptlsgfwhwavanlpanvtelpegvgdgrelpggaltlvndagmrryvgaapppghgvhryyvavha vkvekldlpedaspaylgfnlfqhaiaravifgtyeqr
      BLAST   FFAS

    Structure Determination
    Method Chains
    Resolution (Å) Rfree
    Matthews' coefficent Rfactor
    Waters Solvent Content

    Ligand Information


    Google Scholar output for 2bt5

    Protein Summary

    Ligand Summary




    No references found.

    Tag page
    • No tags

    Files (0)

    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch