The Open Protein Structure Annotation Network
PDB Keyword


    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Structural analysis reveals DNA binding properties of Rv2827c, a hypothetical protein from Mycobacterium tuberculosis. J Struct Funct Genomics 10 137-150 2009
    Site XMTB
    PDB Id 1zel Target Id rv2827c
    Molecular Characteristics
    Source Mycobacterium tuberculosis h37rv
    Alias Ids TPS12013, Molecular Weight 32313.29 Da.
    Residues 295 Isoelectric Point 9.29
    Sequence vvspagadrriptwasrvvsglardrpvvvtkedltqrlteagcgrdpdsairelrrigwlvqlpvkgt wafippgeaaisdpylplrswlardqnagfmlagasaawhlgyldrqpdgripiwlppakrlpdglasy vsvvripwnaadtallaprpallvrrrldlvawatglpalgpeallvqiatrpasfgpwadlvphlddl vadcsderlerllsgrptsawqrasylldsggepargqallakrhtevmpvtrfttahsrdrgesvwap eyqlvdelvvpllrvigka
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 2
    Resolution (Å) 1.93 Rfree 0.22455
    Matthews' coefficent 2.10 Rfactor 0.18136
    Waters 340 Solvent Content 42.20

    Ligand Information
    Ligands MPD ((4S)-2-METHYL-2,4-PENTANEDIOL) x 1;FMT (FORMIC) x 15;ACT (ACETATE) x 2
    Metals NA (SODIUM) x 2


    Google Scholar output for 1zel

    Protein Summary

    Ligand Summary




    No references found.

    Tag page

    Files (0)

    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch