.
The Open Protein Structure Annotation Network
PDB Keyword
.

1w66

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title The Mycobacterium Tuberculosis Lipb Enzyme Functions as a Cysteine/Lysine Dyad Acyltransferase. Proc.Natl.Acad.Sci.USA 103 8662 2006
    Site XMTB
    PDB Id 1w66 Target Id rv2217
    Molecular Characteristics
    Source Mycobacterium tuberculosis h37rv
    Alias Ids TPS11997, Molecular Weight 24177.21 Da.
    Residues 230 Isoelectric Point 6.32
    Sequence vtgsirsklsaidvrqlgtvdyrtawqlqreladarvaggadtllllehpavytagrrtetherpidgt pvvdtdrggkitwhgpgqlvgypiiglaepldvvnyvrrleesliqvcadlglhagrvdgrsgvwlpgr parkvaaigvrvsrattlhgfalncdcdlaaftaivpcgisdaavtslsaelgrtvtvdevratvaaav caaldgvlpvgdrvpshavpspl
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 1
    Resolution (Å) 1.08 Rfree 0.1458
    Matthews' coefficent 1.92 Rfactor
    Waters 349 Solvent Content 35.9

    Ligand Information
    Ligands DKA (DECANOIC) x 1
    Metals

    Jmol

     
    Google Scholar output for 1w66

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch