.
The Open Protein Structure Annotation Network
PDB Keyword
.

1w0d

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title The High Resolution Structure of Leub (Rv2995C) from Mycobacterium Tuberculosis. J.Mol.Biol. 346 1 2005
    Site XMTB
    PDB Id 1w0d Target Id rv2995c
    Molecular Characteristics
    Source Mycobacterium tuberculosis h37rv
    Alias Ids TPS12012, Molecular Weight 35304.04 Da.
    Residues 336 Isoelectric Point 5.44
    Sequence mklaiiagdgigpevtaeavkvldavvpgvqktsydlgarrfhatgevlpdsvvaelrnhdaillgaig dpsvpsgvlerglllrlrfeldhhinlrparlypgvasplsgnpgidfvvvregtegpytgnggairvg tpnevatevsvntafgvrrvvadaferarrrrkhltlvhktnvltfagglwlrtvdevgecypdvevay qhvdaatihmitdpgrfdvivtdnlfgdiitdlaaavcggiglaasgnidatranpsmfepvhgsapdi agqgiadptaaimsvalllshlgehdaaarvdraveahlatrgserlatsdvgeriaaal
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 4
    Resolution (Å) 1.65 Rfree 0.241
    Matthews' coefficent 2.44 Rfactor 0.213
    Waters 579 Solvent Content 49.6

    Ligand Information
    Ligands SO4 (SULFATE) x 1
    Metals

    Jmol

     
    Google Scholar output for 1w0d

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch