.
The Open Protein Structure Annotation Network
PDB Keyword
.

3bue

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Structure of the C-terminal domain of the arginine repressor protein from Mycobacterium tuberculosis. Acta Crystallogr.,Sect.D 64 950-956 2008
    Site TBSGC
    PDB Id 3bue Target Id Rv1657
    Molecular Characteristics
    Source Mycobacterium tuberculosis h37rv
    Alias Ids TPS27461,15608795, P0A4Y8, 15608795, P94992, NP_216173.1 Molecular Weight 17348.64 Da.
    Residues 170 Isoelectric Point 5.19
    Sequence msrakaapvagpevaanragrqarivailssaqvrsqnelaallaaegievtqatlsrdleelgavklr gadggtgiyvvpedgspvrgvsggtdrmarllgellvstddsgnlavlrtppgaahylasaidraalpq vvgtiagddtilvvarepttgaqlagmfenlr
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 6
    Resolution (Å) 2.15 Rfree 0.23464
    Matthews' coefficent 2.89 Rfactor 0.16795
    Waters 361 Solvent Content 57.44

    Ligand Information
    Ligands
    Metals

    Jmol

     
    Google Scholar output for 3bue

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch