.
The Open Protein Structure Annotation Network
PDB Keyword
.

2o0r

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title The Three-dimensional Structure of N-Succinyldiaminopimelate Aminotransferase from Mycobacterium tuberculosis. J.Mol.Biol. 367 825-838 2007
    Site TBSGC
    PDB Id 2o0r Target Id Rv0858c
    Molecular Characteristics
    Source
    Alias Ids TPS27448,15607998, O53870, 15607998, NP_215373.1 Molecular Weight 42206.60 Da.
    Residues 397 Isoelectric Point 5.34
    Sequence mtvsrlrpyattvfaemsalatrigavnlgqgfpdedgppkmlqaaqdaiaggvnqyppgpgsaplrra iaaqrrrhfgvdydpetevlvtvgateaiaaavlglvepgsevlliepfydsyspvvamagahrvtvpl vpdgrgfaldadalrravtprtraliinsphnptgavlsatelaaiaeiavaanlvvitdevyehlvfd harhlplagfdgmaertitissaakmfnctgwkigwacgpaeliagvraakqylsyvggapfqpavala ldtedawvaalrnslrarrdrlaaglteigfavhdsygtyflcadprplgyddstefcaalpekvgvaa ipmsafcdpaagqasqqadvwnhlvrftfckrddtldeairrlsvlaerpat
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 2
    Resolution (Å) 2.00 Rfree 0.213
    Matthews' coefficent 2.14 Rfactor 0.164
    Waters 457 Solvent Content 42.48

    Ligand Information
    Ligands GOL (GLYCEROL) x 2
    Metals CL (CHLORIDE) x 2;NA (SODIUM) x 1

    Jmol

     
    Google Scholar output for 2o0r

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch