.
The Open Protein Structure Annotation Network
PDB Keyword
.

2iry

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Structure and function of a mycobacterial NHEJ DNA repair polymerase. J.Mol.Biol. 366 391-405 2007
    Site TBSGC
    PDB Id 2iry Target Id Rv0938
    Related PDB Ids 1vs0 2irx 
    Molecular Characteristics
    Source
    Alias Ids TPS9446,15608078, P71571, 15608078, P71571, NP_215453.1 Molecular Weight 83567.85 Da.
    Residues 759 Isoelectric Point 7.39
    Sequence mgsaseqrvtltnadkvlypatgttksdifdyyagvaevmlghiagrpatrkrwpngvdqpaffekqla lsappwlsratvahrsgtttypiidsatglawiaqqaalevhvpqwrfvaepgsgelnpgpatrlvfdl dpgegvmmaqlaevaravrdlladiglvtfpvtsgskglhlytpldepvssrgatvlakrvaqrleqam palvtstmtkslragkvfvdwsqnsgskttiapyslrgrthptvaaprtwaelddpalrqlsydevltr iardgdllerldadapvadrltryrrmrdasktpepiptakpvtgdgntfviqehharrphydfrlecd gvlvswavpknlpdntsvnhlaihtedhpleyatfegaipsgeygagkviiwdsgtydtekfhddphtg evivnlhggrisgryalirtngdrwlahrlknqkdqkvfefdnlapmlathgtvaglkasqwafegkwd gyrllveadhgavrlrsrsgrdvtaeypqlralaedladhhvvldgeavvldssgvpsfsqmqnrgrdt rvefwafdllyldgrallgtryqdrrklletlanatsltvpellpgdgaqafacsrkhgwegviakrrd sryqpgrrcaswvkdkhwntqevviggwrageggrssgvgsllmgipgpgglqfagrvgtglserelan lkemlaplhtdespfdvplpardakgityvkpalvaevrysewtpegrlrqsswrglrpdkkpsevvre
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 2
    Resolution (Å) 1.78 Rfree 0.23034
    Matthews' coefficent 2.28 Rfactor 0.18206
    Waters 659 Solvent Content 46.01

    Ligand Information
    Ligands DGT (2'-DEOXYGUANOSINE-5'-TRIPHOSPHATE) x 2
    Metals MN (MANGANESE) x 2

    Jmol

     
    Google Scholar output for 2iry

    Protein Summary

     

    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch