The Open Protein Structure Annotation Network
PDB Keyword


    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Crystallographic and mutational studies of Mycobacterium tuberculosis recA mini-inteins suggest a pivotal role for a highly conserved aspartate residue. J.Mol.Biol. 367 162-173 2007
    Site TBSGC
    PDB Id 2in9 Target Id Rv2737c
    Related PDB Ids 1g19 1g18 1mo3 1mo4 1mo5 1mo6 2imz 2in0 2in8 
    Molecular Characteristics
    Alias Ids TPS20700,15609874, P0A5U4, 15609874, NP_217253.1 Molecular Weight 85384.39 Da.
    Residues 790 Isoelectric Point 6.01
    Sequence mtqtpdrekalelavaqieksygkgsvmrlgdearqpisviptgsialdvalgigglprgrvieiygpe ssgkttvalhavanaqaaggvaafidaehaldpdyakklgvdtdsllvsqpdtgeqaleiadmlirsga ldivvidsvaalvpraelegemgdshvglqarlmsqalrkmtgalnnsgttaifinqlrdkigvmfgsp etttggkalkfyasvrmdvrrvetlkdgtnavgnrtrvkvvknkclaegtrifdpvtgtthriedvvdg rkpihvvaaakdgtlharpvvswfdqgtrdviglriaggaivwatpdhkvlteygwraagelrkgdrva qprrfdgfgdsapipadharllgyligdgrdgwvggktpinfinvqraliddvtriaatlgcaahpqgr islaiahrpgerngvadlcqqagiygklawektipnwffepdiaadivgnllfglfesdgwvsreqtga lrvgytttseqlahqihwlllrfgvgstvrdydptqkrpsivngrriqskrqvfevrisgmdnvtafae svpmwgprgaaliqaipeatqgrrrgsqatylaaemtdavlnyldergvtaqeaaamigvasgdprggm kqvlgasrlrrdrvqaladalddkflhdmlaeelrysvirevlptrrartfdleveelhtlvaegvvvh ncsppfkqaefdilygkgisregslidmgvdqglirksgawftyegeqlgqgkenarnflvenadvade iekkikeklgigavvtddpsndgvlpapvdf
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 1
    Resolution (Å) 1.80 Rfree 0.285
    Matthews' coefficent 1.89 Rfactor 0.236
    Waters 95 Solvent Content 34.97

    Ligand Information
    Ligands SO4 (SULFATE) x 1


    Google Scholar output for 2in9

    Protein Summary

    Ligand Summary




    No references found.

    Tag page
    • No tags

    Files (0)

    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch