.
The Open Protein Structure Annotation Network
PDB Keyword
.

2gq3

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title The product complex of M. tuberculosis malate synthase revisited. Protein Sci. 15 2002-2007 2006
    Site TBSGC
    PDB Id 2gq3 Target Id Rv1837c
    Related PDB Ids 1n8i 1n8w 
    Molecular Characteristics
    Source
    Alias Ids TPS27476,15608974, P0A5J4, NP_216353.1 Molecular Weight 80398.54 Da.
    Residues 741 Isoelectric Point 5.03
    Sequence mtdrvsvgnlriarvlydfvnnealpgtdidpdsfwagvdkvvadltpqnqallnardelqaqidkwhr rrviepidmdayrqflteigyllpepddftittsgvdaeitttagpqlvvpvlnarfalnaanarwgsl ydalygtdvipetdgaekgptynkvrgdkviayarkflddsvplssgsfgdatgftvqdgqlvvalpdk stglanpgqfagytgaaesptsvllinhglhieilidpesqvgttdragvkdvilesaittimdfedsv aavdaadkvlgyrnwlglnkgdlaaavdkdgtaflrvlnrdrnytapgggqftlpgrslmfvrnvghlm tndaivdtdgsevfegimdalftgliaihglkasdvngplinsrtgsiyivkpkmhgpaevaftcelfs rvedvlglpqntmkigimdeerrttvnlkacikaaadrvvfintgfldrtgdeihtsmeagpmvrkgtm ksqpwilayedhnvdaglaagfsgraqvgkgmwtmtelmadmvetkiaqpragastawvpsptaatlha lhyhqvdvaavqqglagkrratieqlltiplakelawapdeireevdnncqsilgyvvrwvdqgvgcsk vpdihdvalmedratlrissqllanwlrhgvitsadvraslermaplvdrqnagdvayrpmapnfddsi aflaaqelilsgaqqpngytepilhrrrrefkaraaekpapsdragddaar
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 2
    Resolution (Å) 2.30 Rfree 0.244
    Matthews' coefficent 2.73 Rfactor 0.178
    Waters 617 Solvent Content 55.03

    Ligand Information
    Ligands MLT (MALATE) x 2;COA (COENZYME) x 1;EPE (4-(2-HYDROXYETHYL)-1-PIPERAZINE) x 2
    Metals MG (MAGNESIUM) x 4

    Jmol

     
    Google Scholar output for 2gq3

    Protein Summary

    The gene 15608974 from M. tuberculosis encodes the malate synthase PF01274 EC:2.3.3.9 COG2225 (alternative names: glyoxylate transacetase, malate synthetase, malic synthetase).  The structure of the enzyme from the same organism has been previously solved 1N8I.  The enzyme belongs to the class of alpha and beta (a+b) proteins and reveals TIM beta/alpha-barrel fold type SCOP51350.  This enzyme belongs to the family of transferases, specifically those acyltransferases that convert acyl groups into alkyl groups on transfer.   The enzyme catalyzes the reaction: cetyl-CoA + H2O + glyoxylate --> (S)-malate + CoA.  The enzyme participates in pyruvate metabolism and glyoxylate and dicarboxylate metabolism.  This is part of a bypass of the tricarboxylic acid cycle in which isocitrate lyase and malate synthase (GlcB) catalyze the net incorporation of carbon during growth of microorganisms on acetate or fatty acids as the primary carbon source.  Establishment or maintenance of a persistent infection by Mycobacterium tuberculosis requires the glyoxylate pathway [Ref].

    Ligand Summary

    Reviews

    References

     

    1. (No Results)

       


      Discuss this publication
    Tag page

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch