.
The Open Protein Structure Annotation Network
PDB Keyword
.

2gp6

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title X-Ray Crystal Structure of Mycobacterium tuberculosis beta-Ketoacyl Acyl Carrier Protein Synthase II (mtKasB). J.Mol.Biol. 366 469-480 2007
    Site TBSGC
    PDB Id 2gp6 Target Id Rv2246
    Molecular Characteristics
    Source
    Alias Ids TPS20681,15609383, P63456, P63456, NP_216762.1 Molecular Weight 46418.15 Da.
    Residues 438 Isoelectric Point 5.29
    Sequence mgvpplagasrtdmegtfarpmtelvtgkafpyvvvtgiamttalatdaettwkllldrqsgirtlddp fveefdlpvrigghlleefdhqltrielrrmgylqrmstvlsrrlwenagspevdtnrlmvsigtglgs aeelvfsyddmrargmkavspltvqkympngaaaavglerhakagvmtpvsacasgaeaiarawqqivl geadaaicggvetrieavpiagfaqmrivmstnnddpagacrpfdrdrdgfvfgeggalllieteehak arganilarimgasitsdgfhmvapdpngeraghaitraiqlaglapgdidhvnahatgtqvgdlaegr ainnalggnrpavyapksalghsvgavgavesiltvlalrdqvipptlnlvnldpeidldvvageprpg nyryainnsfgfgghnvaiafgry
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 2
    Resolution (Å) 2.40 Rfree 0.232
    Matthews' coefficent 2.95 Rfactor 0.177
    Waters 229 Solvent Content 58.37

    Ligand Information
    Ligands
    Metals

    Jmol

     
    Google Scholar output for 2gp6

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch