The Open Protein Structure Annotation Network
PDB Keyword


    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Ligand interactions in the distal heme pocket of Mycobacterium tuberculosis truncated hemoglobin N: roles of TyrB10 and GlnE11 residues. Biochemistry 45 8770-8781 2006
    Site TBSGC
    PDB Id 2gln Target Id Rv1542C
    Related PDB Ids 1idr 1s56 1s61 1rte 2gkm 2gkn 2gl3 
    Molecular Characteristics
    Alias Ids TPS27463,15608680, P0A592, 15608680, Q10784, NP_216058.1 Molecular Weight 14447.77 Da.
    Residues 136 Isoelectric Point 5.66
    Sequence mgllsrlrkrepisiydkiggheaievvvedfyvrvladdqlsaffsgtnmsrlkgkqveffaaalggp epytgapmkqvhqgrgitmhhfslvaghladaltaagvpsetiteilgviaplavdvtsgesttapv
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 2
    Resolution (Å) 1.98 Rfree 0.23345
    Matthews' coefficent 2.11 Rfactor 0.1733
    Waters 191 Solvent Content 41.67

    Ligand Information
    Ligands PO4 (PHOSPHATE) x 2;CYN-HEM (CYANIDE) x 2
    Metals NA (SODIUM) x 1


    Google Scholar output for 2gln

    Protein Summary

    Ligand Summary




    No references found.

    Tag page
    • No tags

    Files (0)

    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch