The Open Protein Structure Annotation Network
PDB Keyword


    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Crystal Structure and Activity Studies of the Mycobacterium tuberculosis {beta}-Lactamase Reveal Its Critical Role in Resistance to {beta}-Lactam Antibiotics. Antimicrob.Agents Chemother. 50 2762-2771 2006
    Site TBSGC
    PDB Id 2gdn Target Id Rv2068c
    Molecular Characteristics
    Alias Ids TPS20667,15609205, P0A5I6, 15609205, NP_216584.1 Molecular Weight 32565.95 Da.
    Residues 307 Isoelectric Point 5.77
    Sequence mrnrgfgrrellvamamlvsvtgcarhasgarpasttlpagadladrfaelerrydarlgvyvpatgtt aaieyraderfafcstfkaplvaavlhqnplthldklitytsddirsispvaqqhvqtgmtigqlcdaa irysdgtaanllladlggpgggtaaftgylrslgdtvsrldaeepelnrdppgderdtttphaialvlq qlvlgnalppdkralltdwmarnttgakriragfpadwkvidktgtgdygrandiavvwsptgvpyvva vmsdragggydaepreallaeaatcvagvla
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 1
    Resolution (Å) 1.72 Rfree 0.213
    Matthews' coefficent 2.29 Rfactor 0.18
    Waters 248 Solvent Content 46.37

    Ligand Information


    Google Scholar output for 2gdn

    Protein Summary

    Ligand Summary




    No references found.

    Tag page
    • No tags

    Files (0)

    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch