.
The Open Protein Structure Annotation Network
PDB Keyword
.

2fsx

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Crystal Structure of Rv0390 from Mycobacterium tuberculosis. To be Published
    Site TBSGC
    PDB Id 2fsx Target Id Rv0390
    Molecular Characteristics
    Source
    Alias Ids TPS9431,15607531, P95198, 15607531, NP_214904.1 Molecular Weight 15391.24 Da.
    Residues 140 Isoelectric Point 4.68
    Sequence msyagditplqawemlsdnpravlvdvrceaewrfvgvpdlsslgrevvyvewatsdgthndnflaelr dripadadqherpviflcrsgnrsigaaevateagitpaynvldgfeghldaeghrgatgwravglpwr qg
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 1
    Resolution (Å) 1.80 Rfree 0.21767
    Matthews' coefficent 2.50 Rfactor 0.17415
    Waters 123 Solvent Content 50.81

    Ligand Information
    Ligands SO4 (SULFATE) x 1
    Metals BR (BROMIDE) x 10

    Jmol

     
    Google Scholar output for 2fsx

    Protein Summary

     

    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch