.
The Open Protein Structure Annotation Network
PDB Keyword
.

2cig

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Mycobacterium Tuberculosis Dihydrofolate Reductase is a Target for Isoniazid. Nat.Struct.Mol.Biol. 13 408 2006
    Site TBSGC
    PDB Id 2cig Target Id Rv2763c
    Related PDB Ids 1dg8 1dg7 1dg5 1df7 
    Molecular Characteristics
    Source
    Alias Ids TPS27467,15609900, P0A546, 15609900, NP_217279.1 Molecular Weight 17639.09 Da.
    Residues 159 Isoelectric Point 6.30
    Sequence mvgliwaqatsgvigrggdipwrlpedqahfreitmghtivmgrrtwdslpakvrplpgrrnvvlsrqa dfmasgaevvgsleealtspetwvigggqvyalalpyatrcevtevdiglpreagdalapvldetwrge tgewrfsrsglryrlysyhrs
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 1
    Resolution (Å) 1.9 Rfree 0.212
    Matthews' coefficent 2.64 Rfactor 0.178
    Waters 137 Solvent Content 53.10

    Ligand Information
    Ligands 1DG ((4R)-ISONICOTINIC-ACETYL-NICOTINAMIDE-) x 1;GOL (GLYCEROL) x 4;SO4 (SULFATE) x 2
    Metals

    Jmol

     
    Google Scholar output for 2cig

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch