The Open Protein Structure Annotation Network
PDB Keyword


    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Three Dimensional Structure of Bifunctional Methylenetetrahydrofolate Dehydrogenase-Cyclohydrolase from Mycobacterium Tuberculosis. To be Published
    Site TBSGC
    PDB Id 2c2x Target Id Rv3356c
    Related PDB Ids 2c2y 
    Molecular Characteristics
    Alias Ids TPS20717,15610492, O50385, 15610492, O50385, NP_217873.1 Molecular Weight 29482.06 Da.
    Residues 281 Isoelectric Point 5.97
    Sequence mgaimldgkatrdeifgdlkqrvaaldaagrtpglgtilvgddpgsqayvrgkhadcakvgitsirrdl padistatlnetidelnanpdctgyivqlplpkhldenaalervdpakdadglhptnlgrlvlgtpapl pctprgivhllrrydisiagahvvvigrgvtvgrplgllltrrsenatvtlchtgtrdlpaltrqadiv vaavgvahlltadmvrpgaavidvgvsrtddglvgdvhpdvwelaghvspnpggvgpltraflltnvve laerr
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 2
    Resolution (Å) 2.0 Rfree 0.248
    Matthews' coefficent 2.35 Rfactor 0.206
    Waters 260 Solvent Content 47.15

    Ligand Information


    Google Scholar output for 2c2x

    Protein Summary

    Ligand Summary




    No references found.

    Tag page
    • No tags

    Files (0)

    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch