.
The Open Protein Structure Annotation Network
PDB Keyword
.

2bvc

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Structure of Mycobacterium Tuberculosis Glutamine Synthetase in Complex with a Transition-State Mimic Provides Functional Insights. Proc.Natl.Acad.Sci.USA 102 10499 2005
    Site TBSGC
    PDB Id 2bvc Target Id Rv2220
    Related PDB Ids 1hto 1htq 
    Molecular Characteristics
    Source
    Alias Ids TPS20675,15609357, P0A590, 15609357, Q10377, NP_216736.1 Molecular Weight 53567.09 Da.
    Residues 478 Isoelectric Point 5.04
    Sequence mtektpddvfklakdekveyvdvrfcdlpgimqhftipasafdksvfddglafdgssirgfqsihesdm lllpdpetaridpfraaktlninffvhdpftlepysrdprniarkaenylistgiadtayfgaeaefyi fdsvsfdsrangsfyevdaisgwwntgaateadgspnrgykvrhkggyfpvapndqyvdlrdkmltnli nsgfilekghhevgsggqaeinyqfnsllhaaddmqlykyiikntawqngktvtfmpkplfgdngsgmh chqslwkdgaplmydetgyaglsdtarhyiggllhhapsllaftnptvnsykrlvpgyeapinlvysqr nrsacvripitgsnpkakrlefrspdssgnpylafsamlmagldgiknkiepqapvdkdlyelppeeaa sipqtptqlsdvidrleadheylteggvftndlietwisfkreneiepvnirphpyefalyydv
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 6
    Resolution (Å) 2.1 Rfree 0.230
    Matthews' coefficent 2.5 Rfactor 0.191
    Waters 621 Solvent Content 50

    Ligand Information
    Ligands P3S (L-METHIONINE-S-SULFOXIMINE) x 6;ADP (ADENOSINE-5'-DIPHOSPHATE) x 6
    Metals CL (CHLORIDE) x 6;MG (MAGNESIUM) x 18

    Jmol

     
    Google Scholar output for 2bvc

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch