The Open Protein Structure Annotation Network
PDB Keyword


    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title The structure of 3-deoxy-d-arabino-heptulosonate 7-phosphate synthase from Mycobacterium tuberculosis reveals a common catalytic scaffold and ancestry for type I and type II enzymes. J.Mol.Biol. 354 927-939 2005
    Site TBSGC
    PDB Id 2b7o Target Id Rv2178c
    Related PDB Ids 2b70 
    Molecular Characteristics
    Source Mycobacterium tuberculosis h37rv
    Alias Ids TPS20671,15609315, O53512, 15609315, O53512, NP_216694.1 Molecular Weight 50638.68 Da.
    Residues 462 Isoelectric Point 5.46
    Sequence mnwtvdipidqlpslpplptdlrtrldaalakpaaqqptwpadqalamrtvlesvppvtvpseivrlqe qlaqvakgeafllqggdcaetfmdntephirgnvrallqmavvltygasmpvvkvariagqyakprsad idalglrsyrgdmingfapdaaarehdpsrlvrayanasaamnlvraltssglaslhlvhdwnrefvrt spagaryealateidrglrfmsacgvadrnlqtaeiyashealvldyeramlrlsdgddgepqlfdlsa htvwigertrqidgahiafaqvianpvgvklgpnmtpelaveyverldphnkpgrltlvsrmgnhkvrd llppivekvqatghqviwqcdpmhgnthesstgfktrhfdrivdevqgffevhralgthpggihveitg envteclggaqdisetdlagryetacdprlntqqslelaflvaemlrd
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 2
    Resolution (Å) 2.30 Rfree 0.22429
    Matthews' coefficent 3.90 Rfactor 0.18778
    Waters 336 Solvent Content 68.00

    Ligand Information
    Metals MN (MANGANESE) x 2


    Google Scholar output for 2b7o

    Protein Summary

    Ligand Summary




    No references found.

    Tag page
    • No tags

    Files (0)

    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch