.
The Open Protein Structure Annotation Network
PDB Keyword
.

2atw

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Structure of a Mycobacterium tuberculosis NusA-RNA complex. Embo J. 24 3576-3587 2005
    Site TBSGC
    PDB Id 2atw Target Id Rv2841c
    Related PDB Ids 1k0r 2asb 
    Molecular Characteristics
    Source
    Alias Ids TPS20702,15609978, P0A5M2, 15609978, NP_217357.1 Molecular Weight 37639.52 Da.
    Residues 347 Isoelectric Point 6.42
    Sequence mnidmaalhaievdrgisvnelletiksalltayrhtqghqtdarieidrktgvvrviaretdeagnli sewddtpegfgriaattarqvmlqrfrdaenertygefstregeivagviqrdsranarglvvvrigte tkasegvipaaeqvpgesyehgnrlrcyvvgvtrgareplitlsrthpnlvrklfslevpeiadgsvei vavareaghrskiavrsnvaglnakgacigpmgqrvrnvmselsgekidiidydddparfvanalspak vvsvsvidqtaraarvvvpdfqlslaigkegqnarlaarltgwridirgdapppppgqpepgvsrgmahdr
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 2
    Resolution (Å) 2.25 Rfree 0.27267
    Matthews' coefficent 2.34 Rfactor 0.20599
    Waters 208 Solvent Content 46.90

    Ligand Information
    Ligands
    Metals

    Jmol

     
    Google Scholar output for 2atw

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch