.
The Open Protein Structure Annotation Network
PDB Keyword
.

2aj9

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Probing the Mechanism of the Mycobacterium tuberculosis beta-Ketoacyl-Acyl Carrier Protein Synthase III mtFabH: Factors Influencing Catalysis And Substrate Specificity. J.Biol.Chem. 280 32539-32547 2005
    Site TBSGC
    PDB Id 2aj9 Target Id Rv0533c
    Related PDB Ids 1hzp 1m1m 2ahb 
    Molecular Characteristics
    Source
    Alias Ids TPS9438,15607673, P0A574, 15607673, NP_215047.1 Molecular Weight 34870.46 Da.
    Residues 335 Isoelectric Point 4.98
    Sequence mteiattsgarsvgllsvgayrpervvtndeicqhidssdewiytrtgiktrrfaaddesaasmateac rralsnaglsaadidgvivttnthflqtppaapmvaaslgakgilgfdlsagcagfgyalgaaadmirg ggaatmlvvgteklsptidmydrgncfifadgaaavvvgetpfqgigptvagsdgeqadairqdidwit faqnpsgprpfvrlegpavfrwaafkmgdvgrramdaagvrpdqidvfvphqansrinellvknlqlrp davvandiehtgntsaasiplamaellttgaakpgdlalligygaglsyaaqvvrmpkg
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 2
    Resolution (Å) 2.50 Rfree 0.279
    Matthews' coefficent 2.30 Rfactor 0.225
    Waters 101 Solvent Content 45.30

    Ligand Information
    Ligands
    Metals

    Jmol

     
    Google Scholar output for 2aj9

    Protein Summary

     

    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch