.
The Open Protein Structure Annotation Network
PDB Keyword
.

2a88

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Crystal Structure of the Pantothenate Synthetase from Mycobacterium tuberculosis, Snapshots of the Enzyme in Action. Biochemistry 45 1554-1561 2006
    Site TBSGC
    PDB Id 2a88 Target Id Rv3602c
    Related PDB Ids 1mop 1n2b 1n2e 1n2g 1n2h 1n2i 1n2j 1n2o 2a84 2a86 2a7x 
    Molecular Characteristics
    Source
    Alias Ids TPS20722,15610738, P0A5R0, 15610738, NP_218119.1 Molecular Weight 32675.60 Da.
    Residues 309 Isoelectric Point 5.70
    Sequence mtipafhpgelnvysapgdvadvsralrltgrrvmlvptmgalheghlalvraakrvpgsvvvvsifvn pmqfgagedldayprtpdddlaqlraegveiaftpttaamypdglrttvqpgplaaeleggprpthfag vltvvlkllqivrpdrvffgekdyqqlvlirqlvadfnldvavvgvptvreadglamssrnryldpaqr aaavalsaaltaaahaatagaqaaldaaravldaapgvavdylelrdiglgpmplngsgrllvaarlgt trlldniaieigtfagtdrpdgyraileshwrn
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 1
    Resolution (Å) 1.70 Rfree 0.186
    Matthews' coefficent 2.87 Rfactor 0.152
    Waters 287 Solvent Content 57.20

    Ligand Information
    Ligands SO4 (SULFATE) x 1;GOL (GLYCEROL) x 2
    Metals

    Jmol

     
    Google Scholar output for 2a88

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch