.
The Open Protein Structure Annotation Network
PDB Keyword
.

2a87

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Conformational flexibility of Mycobacterium tuberculosis thioredoxin reductase: crystal structure and normal-mode analysis. Acta Crystallogr.,Sect.D 61 1603-1611 2005
    Site TBSGC
    PDB Id 2a87 Target Id Rv3913
    Molecular Characteristics
    Source
    Alias Ids TPS20798,15611049, P52214, 15611049, NP_218430.1 Molecular Weight 35641.02 Da.
    Residues 335 Isoelectric Point 5.30
    Sequence mtappvhdrahhpvrdvivigsgpagytaalyaaraqlaplvfegtsfggalmtttdvenypgfrngit gpelmdemreqalrfgadlrmedvesvslhgplksvvtadgqthraravilamgaaarylqvpgeqell grgvsscatcdgfffrdqdiavigggdsameeatfltrfarsvtlvhrrdefraskimldrarnndkir fltnhtvvavdgdttvtglrvrdtntgaettlpvtgvfvaigheprsglvreaidvdpdgyvlvqgrtt stslpgvfaagdlvdrtyrqavtaagsgcaaaidaerwlaehaatgeadstdaligaqr
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 2
    Resolution (Å) 3.00 Rfree 0.29066
    Matthews' coefficent 2.50 Rfactor 0.21132
    Waters 16 Solvent Content 51.40

    Ligand Information
    Ligands FAD (FLAVIN-ADENINE) x 2;NAP (NADP) x 2
    Metals MG (MAGNESIUM) x 2

    Jmol

     
    Google Scholar output for 2a87

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch