The Open Protein Structure Annotation Network
PDB Keyword


    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Structural and Functional Analysis of Rv3214 from Mycobacterium tuberculosis, a Protein with Conflicting Functional Annotations, Leads to Its Characterization as a Phosphatase. J.Bacteriol. 188 3589-3599 2006
    Site TBSGC
    PDB Id 2a6p Target Id Rv3214
    Molecular Characteristics
    Alias Ids TPS20715,57117074, Q6MWZ7, 57117074, Q6MWZ7, YP_177944.1 Molecular Weight 21947.62 Da.
    Residues 203 Isoelectric Point 5.54
    Sequence mgvrnhrllllrhgetawstlgrhtggteveltdtgrtqaelagqllgelelddpivicsprrrtldta klagltvnevtgllaewdygsyeglttpqiresepdwlvwthgcpagesvaqvndradsavalalehms srdvlfvshghfsravitrwvqlplaegsrfamptasigicgfehgvrqlavlgltghpqpiaag
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 2
    Resolution (Å) 2.20 Rfree 0.226
    Matthews' coefficent 2.00 Rfactor 0.209
    Waters 106 Solvent Content 37.70

    Ligand Information
    Ligands SO4 (SULFATE) x 2;GOL (GLYCEROL) x 2


    Google Scholar output for 2a6p

    Protein Summary

    Ligand Summary




    No references found.

    Tag page
    • No tags

    Files (0)

    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch