The Open Protein Structure Annotation Network
PDB Keyword


    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Crystal structure of Mycobacterium tuberculosis Rv0760c at 1.50 A resolution, a structural homolog of Delta(5)-3-ketosteroid isomerase. Biochim.Biophys.Acta 1784 1625-1632 2008
    Site TBSGC
    PDB Id 2a15 Target Id Rv0760c
    Related PDB Ids 2z76 2z77 2z7a 
    Molecular Characteristics
    Source Mycobacterium tuberculosis h37rv
    Alias Ids TPS9439,15607900, P71817, 15607900, NP_215274.1 Molecular Weight 15241.26 Da.
    Residues 139 Isoelectric Point 4.84
    Sequence mtqttqspaliasqsswrcvqahdregwlalmaddvviedpigksvtnpdgsgikgkeavgaffdthia anrltvtceetfpssspdeiahilvlhsefdggftsevrgvftyrvnkaglitnmrgywnldmmtfgnqe
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 1
    Resolution (Å) 1.68 Rfree 0.207
    Matthews' coefficent 2.65 Rfactor 0.176
    Waters 190 Solvent Content 53.28

    Ligand Information
    Ligands NCA (NICOTINAMIDE) x 1


    Google Scholar output for 2a15

    Protein Summary

    Ligand Summary




    No references found.

    Tag page
    • No tags

    Files (0)

    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch