.
The Open Protein Structure Annotation Network
PDB Keyword
.

1zzo

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Structure of Mtb DsbF in its oxidized form. To be Published
    Site TBSGC
    PDB Id 1zzo Target Id Rv1677
    Molecular Characteristics
    Source Mycobacterium tuberculosis h37rv
    Alias Ids TPS20507, Molecular Weight 18893.45 Da.
    Residues 179 Isoelectric Point 6.15
    Sequence thsrligaltvvaiivtacgsqpksqpavaptgdaaaatqvpagqtvpaqlqfsaktldghdfhgesllg kpavlwfwawcptcqgeapvvgqvaashpevtfvgvagldqvpamqefvnkypvktftqladtdgsvwa nfgvtqqpayafvdphgnvvvrgrmsqdeltrrvtaltsr
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 1
    Resolution (Å) 1.60 Rfree 0.215
    Matthews' coefficent 2.24 Rfactor 0.1364
    Waters 108 Solvent Content 45.10

    Ligand Information
    Ligands
    Metals

    Jmol

     
    Google Scholar output for 1zzo

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch