The Open Protein Structure Annotation Network
PDB Keyword


    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title The Crystal Structure of TrpD, a Metabolic Enzyme Essential for Lung Colonization by Mycobacterium tuberculosis, in Complex with its Substrate Phosphoribosylpyrophosphate. J.Mol.Biol. 355 784-797 2006
    Site TBSGC
    PDB Id 1zvw Target Id Rv2192c
    Related PDB Ids 2bpq 
    Molecular Characteristics
    Source Mycobacterium tuberculosis h37rv
    Alias Ids TPS20673,15609329, P66992, 15609329, P66992, NP_216708.1 Molecular Weight 37737.56 Da.
    Residues 370 Isoelectric Point 5.99
    Sequence malsaegssggsrggspkaeaasvpswpqilgrltdnrdlargqaawamdqimtgnarpaqiaafavam tmkaptadevgelagvmlshahplpadtvpddavdvvgtggdgvntvnlstmaaivvaaagvpvvkhgn raasslsggadtlealgvridlgpdlvarslaevgigfcfaprfhpsyrhaaavrreigvptvfnllgp ltnparpragligcafadlaevmagvfaarrssvlvvhgddgldeltttttstiwrvaagsvdkltfdp agfgfaraqldqlaggdaqanaaavravlggargpvrdavvlnaagaivahaglssraewlpaweeglr rasaaidtgaaeqllarwvrfgrqi
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 2
    Resolution (Å) 2.30 Rfree 0.255
    Matthews' coefficent 2.56 Rfactor 0.194
    Waters 277 Solvent Content 51.90

    Ligand Information
    Metals MG (MAGNESIUM) x 2


    Google Scholar output for 1zvw

    Protein Summary

    Ligand Summary




    No references found.

    Tag page
    • No tags

    Files (0)

    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch