.
The Open Protein Structure Annotation Network
PDB Keyword
.

1zlk

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Structures of Mycobacterium tuberculosis DosR and DosR-DNA complex involved in gene activation during adaptation to hypoxic latency. J.Mol.Biol. 354 630-641 2005
    Site TBSGC
    PDB Id 1zlk Target Id Rv3133c
    Related PDB Ids 1zlj 
    Molecular Characteristics
    Source
    Alias Ids TPS27444,15610269, P95193, 15610269, P95193, NP_217649.1 Molecular Weight 23292.62 Da.
    Residues 217 Isoelectric Point 5.61
    Sequence mvkvflvddhevvrrglvdllgadpeldvvgeagsvaeamarvpaarpdvavldvrlpdgngielcrdl lsrmpdlrcliltsytsdeamldailagasgyvvkdikgmelaravkdvgagrslldnraaaalmaklr gaaekqdplsgltdqertllgllsegltnkqiadrmflaektvknyvsrllaklgmerrtqaavfatel krsrppgdgp
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 2
    Resolution (Å) 3.10 Rfree 0.28802
    Matthews' coefficent 2.97 Rfactor 0.27154
    Waters Solvent Content 58.64

    Ligand Information
    Ligands
    Metals

    Jmol

     
    Google Scholar output for 1zlk

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch