The Open Protein Structure Annotation Network
PDB Keyword


    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Mycobacterium tuberculosis Protein Tyrosine Phosphatase PtpB Structure Reveals a Diverged Fold and a Buried Active Site. Structure 13 1625-1634 2005
    Site TBSGC
    PDB Id 1ywf Target Id Rv0153c
    Molecular Characteristics
    Alias Ids TPS9430,15607295, P96830, 15607295, NP_214667.1 Molecular Weight 30152.08 Da.
    Residues 276 Isoelectric Point 5.88
    Sequence mavrelpgawnfrdvadtatalrpgrlfrsselsrlddagratlrrlgitdvadlrssrevarrgpgrv pdgidvhllpfpdladddaddsaphetafkrlltndgsngesgessqsindaatrymtdeyrqfptrng aqralhrvvtllaagrpvlthcfagkdrtgfvvalvleavgldrdvivadylrsndsvpqlrarisemi qqrfdtelapevvtftkarlsdgvlgvraeylaaarqtidetygslggylrdagisqatvnrmrgvllg
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 1
    Resolution (Å) 1.71 Rfree 0.21361
    Matthews' coefficent 2.63 Rfactor 0.17567
    Waters 264 Solvent Content 56.40

    Ligand Information
    Ligands PO4 (PHOSPHATE) x 1


    Google Scholar output for 1ywf

    Protein Summary


    Ligand Summary




    No references found.

    Tag page
    • No tags

    Files (0)

    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch