The Open Protein Structure Annotation Network
PDB Keyword


    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title The 1.25 A resolution structure of phosphoribosyl-ATP pyrophosphohydrolase from Mycobacterium tuberculosis. Acta Crystallogr.,Sect.D 64 627-635 2008
    Site TBSGC
    PDB Id 1y6x Target Id Rv2122c
    Molecular Characteristics
    Source Mycobacterium tuberculosis h37rv
    Alias Ids TPS27518,57116947, P0A5B1, 57116947, YP_177860.1 Molecular Weight 10274.03 Da.
    Residues 93 Isoelectric Point 4.63
    Sequence mqqslavktfedlfaelgdrartrpadsttvaaldggvhalgkklleeagevwlaaehesndalaeeis qllywtqvlmisrglslddvyrkl
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 1
    Resolution (Å) 1.25 Rfree 0.20747
    Matthews' coefficent 2.50 Rfactor 0.18336
    Waters 151 Solvent Content 37.00

    Ligand Information


    Google Scholar output for 1y6x

    Protein Summary

    Ligand Summary




    No references found.

    Tag page
    • No tags

    Files (0)

    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch