.
The Open Protein Structure Annotation Network
PDB Keyword
.

1y0h

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title The crystal structure of Rv0793, a hypothetical monooxygenase from M. tuberculosis. J.STRUCT.FUNCT.GENOM. 6 245-257 2005
    Site TBSGC
    PDB Id 1y0h Target Id Rv0793
    Molecular Characteristics
    Source Mycobacterium tuberculosis h37rv
    Alias Ids TPS9443,15607933, O86332, 15607933, NP_215308.1 Molecular Weight 11191.06 Da.
    Residues 101 Isoelectric Point 5.61
    Sequence mtspvaviarfmprpdarsalralldamitptraedgcrsydlyesadggelvlferyrsrialdehrg sphylnyraqvgelltrpvavtvlapldeasa
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 2
    Resolution (Å) 1.60 Rfree 0.219
    Matthews' coefficent 1.84 Rfactor 0.173
    Waters 208 Solvent Content 33.20

    Ligand Information
    Ligands ACT (ACETATE) x 3
    Metals

    Jmol

     
    Google Scholar output for 1y0h

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch