.
The Open Protein Structure Annotation Network
PDB Keyword
.

1xxu

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Crystal Structure of AhpE from Mycobacterium tuberculosis, a 1-Cys Peroxiredoxin. J.Mol.Biol. 346 1035-1046 2005
    Site TBSGC
    PDB Id 1xxu Target Id Rv2238c
    Related PDB Ids 1xvw 
    Molecular Characteristics
    Source Mycobacterium tuberculosis h37rv
    Alias Ids TPS20678,15609375, P65688, 15609375, NP_216754.1 Molecular Weight 16818.13 Da.
    Residues 153 Isoelectric Point 5.24
    Sequence mlnvgatapdftlrdqnqqlvtlrgyrgaknvllvffplaftgicqgeldqlrdhlpefenddsaalai svgpppthkiwatqsgftfpllsdfwphgavsqaygvfneqagianrgtfvvdrsgiirfaemkqpgev rdqrlwtdalaalta
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 4
    Resolution (Å) 1.90 Rfree 0.286
    Matthews' coefficent 2.80 Rfactor 0.242
    Waters 188 Solvent Content 55.10

    Ligand Information
    Ligands
    Metals

    Jmol

     
    Google Scholar output for 1xxu

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch