The Open Protein Structure Annotation Network
PDB Keyword


    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Characterization of a New Member of the Flavoprotein Disulfide Reductase Family of Enzymes from Mycobacterium tuberculosis. J.Biol.Chem. 279 52694-52702 2004
    Site TBSGC
    PDB Id 1xdi Target Id Rv3303c
    Molecular Characteristics
    Alias Ids TPS27411,15610439, O53355, 15610439, O53355, NP_217820.1 Molecular Weight 51485.98 Da.
    Residues 493 Isoelectric Point 5.87
    Sequence mvtrivilgggpagyeaalvaatshpettqvtvidcdgiggaavlddcvpsktfiastglrtelrraph lgfhidfddakislpqiharvktlaaaqsaditaqllsmgvqviagrgelidstpglarhrikataadg stseheadvvlvatgasprilpsaqpdgeriltwrqlydldalpdhlivvgsgvtgaefvdaytelgvp vtvvasqdhvlpyedadaalvleesfaergvrlfknaraasvtrtgagvlvtmtdgrtvegshalmtig svpntsglglervgiqlgrgnyltvdrvsrtlatgiyaagdctgllplasvaamqgriamyhalgegvs pirlrtvaatvftrpeiaavgvpqsvidagsvaartimlplrtnarakmsemrhgfvkifcrrstgvvi ggvvvapiaselilpiavavqnritvnelaqtlavypslsgsiteaarrlmahddldctaaqdaaeqla lvphhlptsn
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 2
    Resolution (Å) 2.81 Rfree 0.2763
    Matthews' coefficent 2.92 Rfactor 0.1944
    Waters 107 Solvent Content 58.00

    Ligand Information
    Ligands FAD (FLAVIN-ADENINE) x 2


    Google Scholar output for 1xdi

    Protein Summary

    Ligand Summary




    No references found.

    Tag page
    • No tags

    Files (0)

    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch