The Open Protein Structure Annotation Network
PDB Keyword


    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Mycobacterium tuberculosis Antigen 85A and 85C Structures Confirm Binding Orientation and Conserved Substrate Specificity. J.Biol.Chem. 279 36771-36777 2004
    Site TBSGC
    PDB Id 1va5 Target Id Rv0129c
    Related PDB Ids 1dqy 1dqz 
    Molecular Characteristics
    Alias Ids TPS9427,57116693, P0A4V4, 57116693, YP_177694.1 Molecular Weight 36769.33 Da.
    Residues 340 Isoelectric Point 5.92
    Sequence mtffeqvrrlrsaattlprrlaiaamgavlvyglvgtfggpatagafsrpglpveylqvpsasmgrdik vqfqgggphavylldglraqddyngwdintpafeeyyqsglsvimpvggqssfytdwyqpsqsngqnyt ykwetfltrempawlqankgvsptgnaavglsmsggsalilaayypqqfpyaaslsgflnpsegwwptl iglamndsggynansmwgpssdpawkrndpmvqiprlvanntriwvycgngtpsdlggdnipakflegl tlrtnqtfrdtyaadggrngvfnfppngthswpywneqlvamkadiqhvlngatppaapaapaa
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 2
    Resolution (Å) 2.02 Rfree 0.211
    Matthews' coefficent 2.66 Rfactor 0.187
    Waters 252 Solvent Content 53.39

    Ligand Information


    Google Scholar output for 1va5

    Protein Summary


    Ligand Summary




    No references found.

    Tag page
    • No tags

    Files (0)

    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch