The Open Protein Structure Annotation Network
PDB Keyword


    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Structure of Mycobacterium tuberculosis single-stranded DNA-binding protein. Variability in quaternary structure and its implications. J.MOL.BIOL. 331 385-393 2003
    Site TBSGC
    PDB Id 1ue7 Target Id Rv0054
    Related PDB Ids 1ue1 1ue5 1ue6 
    Molecular Characteristics
    Alias Ids TPS9423,15607196, P0A610, 15607196, NP_214568.1 Molecular Weight 17352.11 Da.
    Residues 164 Isoelectric Point 5.12
    Sequence magdttitivgnltadpelrftpsgaavanftvastpriydrqtgewkdgealflrcniwreaaenvae sltrgarvivsgrlkqrsfetregekrtvievevdeigpslryatakvnkasrsggfgsgsrpapaqts sasgddpwgsapasgsfgggddeppf
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 1
    Resolution (Å) 3.20 Rfree 0.313
    Matthews' coefficent 3.68 Rfactor 0.235
    Waters 183 Solvent Content 66.29

    Ligand Information


    Google Scholar output for 1ue7

    Protein Summary


    Ligand Summary




    No references found.

    Tag page
    • No tags

    Files (0)

    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch