.
The Open Protein Structure Annotation Network
PDB Keyword
.

1txo

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title An Alternate Conformation and a Third Metal in PstP/Ppp, the M. tuberculosis PP2C-Family Ser/Thr Protein Phosphatase. Structure 12 1947-1954 2004
    Site TBSGC
    PDB Id 1txo Target Id Rv0018c
    Molecular Characteristics
    Source
    Alias Ids TPS9417,15607160, P71588, 15607160, NP_214532.1 Molecular Weight 53808.71 Da.
    Residues 514 Isoelectric Point 5.05
    Sequence marvtlvlryaarsdrglvrannedsvyagarllaladgmgghaagevasqlviaalahldddepggdl lakldaavragnsaiaaqvemepdlegmgttltailfagnrlglvhigdsrgyllrdgeltqitkddtf vqtlvdegritpeeahshpqrslimraltgheveptltmrearagdryllcsdglsdpvsdetilealq ipevaesahrlielalrgggpdnvtvvvadvvdydygqtqpilagavsgdddqltlpntaagrasaisq rkeivkrvppqadtfsrprwsgrrlafvvalvtvlmtaglligraiirsnyyvadyagsvsimrgiqgs llgmslhqpylmgclsprnelsqisygqsggpldchlmkledlrpperaqvraglpagtlddaigqlre laansllppcpapratsppgrpappttsettepnvtsspaspspttsapaptgttpaiptsaspaapas pptpwpvtssptmaalpppppqpgidcraaa
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 2
    Resolution (Å) 1.95 Rfree 0.23025
    Matthews' coefficent 58.12 Rfactor 0.19904
    Waters 241 Solvent Content 2.96

    Ligand Information
    Ligands
    Metals MN (MANGANESE) x 6

    Jmol

     
    Google Scholar output for 1txo

    Protein Summary

     

    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch