.
The Open Protein Structure Annotation Network
PDB Keyword
.

1sjp

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Crystal Structure of the 65-Kilodalton Heat Shock Protein, Chaperonin 60.2, of Mycobacterium tuberculosis. J.Bacteriol. 186 8105-8113 2004
    Site TBSGC
    PDB Id 1sjp Target Id Rv0440
    Molecular Characteristics
    Source
    Alias Ids TPS9433,15607581, P0A520, NP_214954.1 Molecular Weight 56723.50 Da.
    Residues 540 Isoelectric Point 4.85
    Sequence maktiaydeearrglerglnaladavkvtlgpkgrnvvlekkwgaptitndgvsiakeieledpyekig aelvkevakktddvagdgtttatvlaqalvreglrnvaaganplglkrgiekavekvtetllkgakeve tkeqiaataaisagdqsigdliaeamdkvgnegvitveesntfglqleltegmrfdkgyisgyfvtdpe rqeavledpyillvsskvstvkdllpllekvigagkplliiaedvegealstlvvnkirgtfksvavka pgfgdrrkamlqdmailtggqviseevgltlenadlsllgkarkvvvtkdettivegagdtdaiagrva qirqeiensdsdydreklqerlaklaggvavikagaatevelkerkhriedavrnakaaveegivaggg vtllqaaptldelklegdeatganivkvaleaplkqiafnsglepgvvaekvrnlpaghglnaqtgvye dllaagvadpvkvtrsalqnaasiaglfltteavvadkpekekasvpgggdmggmdf
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 2
    Resolution (Å) 3.20 Rfree 0.2849
    Matthews' coefficent 2.87 Rfactor 0.24142
    Waters Solvent Content 56.77

    Ligand Information
    Ligands
    Metals

    Jmol

     
    Google Scholar output for 1sjp

    Protein Summary

     

    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch